[EcholaListes] Recherche sur contenu : résultats


Recherche de "par pitié" .....

ListepourLesTrolls
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* ... eh toi, ô grand censeur, aie pitié d'un pauvre troll!!
* ... Oups!! les trolls font aussi des fautes d'ortografe, c'est une de leur particularité....!
Convient parfois ?
RecentChanges
* [ListeDeChansonsParlantDuneVilleOuDunPays] ([diff|phpwiki:?diff=ListeDeChansonsParlantDuneVilleOuDunPays]) 16:26 ip:90.44.53.118
* [ListeDisparitionRevenentes] ([diff|phpwiki:?diff=ListeDisparitionRevenentes]) 19:28 ip:90.44.53.118
* [ListeAnecdotiquesDesRuesDeParisOuDailleurs] ([diff|phpwiki:?diff=ListeAnecdotiquesDesRuesDeParisOuDailleurs]) 17:12 ip:82.121.171.201
* [ListeDeMortsAuRallyeParisDakar] ([diff|phpwiki:?diff=ListeDeMortsAuRallyeParisDakar]) 11:38 ip:83.197.109.239
* [ListeDeTitresSurprenantsParmiLesListesDeCeSite] ([diff|phpwiki:?diff=ListeDeTitresSurprenantsParmiLesListesDeCeSite]) 16:36 ip:82.121.173.249
* [ListeDactionsOudeParolesQuiVousFeronsPasserPourUnDingue] ([diff|phpwiki:?diff=ListeDactionsOudeParolesQuiVousFeronsPasserPourUnDingue]) 10:29 ip:89.93.240.22
* [ListePourParlerJeune] ([diff|phpwiki:?diff=ListePourParlerJeune]) 08:29 ip:82.121.166.196
* [ListeDuSavoirParlerJeune] ([diff|phpwiki:?diff=ListeDuSavoirParlerJeune]) 08:24 ip:82.121.166.196
* [ListeDeChansonsAuxParolesTrompeuses] ([diff|phpwiki:?diff=ListeDeChansonsAuxParolesTrompeuses]) 20:48 ip:88.165.129.25
* [ListeDemotfemininseterminantpart] ([diff|phpwiki:?diff=ListeDemotfemininseterminantpart]) 02:20 ip:82.145.211.132
* [ListeDeParfumsInsolites] ([diff|phpwiki:?diff=ListeDeParfumsInsolites]) 19:01 ip:83.114.72.93
* [ListeDesSupportersDuParisSaintGermain] ([diff|phpwiki:?diff=ListeDesSupportersDuParisSaintGermain]) 08:35 ip:82.121.45.81
* [ListePourLaCreationEtlAttributionEnPartieRetroactiveDunPrixNoobelDeLaBoonneActrice] ([diff|phpwiki:?diff=ListePourLaCreationEtlAttributionEnPartieRetroactiveDunPrixNoobelDeLaBoonneActrice]) 08:31 ip:82.121.46.138
* [ListeDeParadis] ([diff|phpwiki:?diff=ListeDeParadis]) 22:32 ip:82.67.63.50
* [ListeDeProposSurParis] ([diff|phpwiki:?diff=ListeDeProposSurParis]) 18:11 ip:82.121.164.206
* [ListeDeParolesdEscorts] ([diff|phpwiki:?diff=ListeDeParolesdEscorts]) 10:41 ip:82.121.164.206
* [ListeDeCigarettesDisparues] ([diff|phpwiki:?diff=ListeDeCigarettesDisparues]) 01:05 ip:186.93.75.172
* [ListeDeVocablesPasTropSympasSeTerminantParAsse] ([diff|phpwiki:?diff=ListeDeVocablesPasTropSympasSeTerminantParAsse]) 18:42 ip:83.114.74.165
* [ListeDeCeQuiVaParSept] ([diff|phpwiki:?diff=ListeDeCeQuiVaParSept]) 08:13 ip:62.244.90.86
* [ListeDeFilmsQuiParlentDeJournalisme] ([diff|phpwiki:?diff=ListeDeFilmsQuiParlentDeJournalisme]) 15:14 ip:62.244.90.86
* [ListeInspireeParLesMangas] ([diff|phpwiki:?diff=ListeInspireeParLesMangas]) 10:50 ip:82.121.39.186
* [ListeDeCeQuiVaParTreize] ([diff|phpwiki:?diff=ListeDeCeQuiVaParTreize]) 09:13 ip:78.246.125.150
* [ListeDesListesImpulseesParJchrbe] ([diff|phpwiki:?diff=ListeDesListesImpulseesParJchrbe]) 18:21 ip:94.109.62.100
* [ListeDeGensCelebresalimparfaitEtAutresTemps] ([diff|phpwiki:?diff=ListeDeGensCelebresalimparfaitEtAutresTemps]) 17:18 ip:78.246.125.150
* [ListedArtistesQuiOntUnNomAvecParticule] ([diff|phpwiki:?diff=ListedArtistesQuiOntUnNomAvecParticule]) 13:16 ip:62.244.90.86
* [ListeDesListesInitialiseesParJoey] ([diff|phpwiki:?diff=ListeDesListesInitialiseesParJoey]) 08:24 ip:62.244.90.86
* [ListedObjetsRendusObsoletesParLesOrdinateursLesPortablesEtLesSmartphones] ([diff|phpwiki:?diff=ListedObjetsRendusObsoletesParLesOrdinateursLesPortablesEtLesSmartphones]) 16:29 ip:82.121.166.247
* [ListeDeCeQuiVaParNeuf] ([diff|phpwiki:?diff=ListeDeCeQuiVaParNeuf]) 15:59 ip:62.244.90.86
* [ListeDeCeQuiVaParDix] ([diff|phpwiki:?diff=ListeDeCeQuiVaParDix]) 15:58 ip:62.244.90.86
* [ListeDeCeQuiVaParOnze] ([diff|phpwiki:?diff=ListeDeCeQuiVaParOnze]) 15:07 ip:62.244.90.86
* [ListeDeCeQuiVaParDouze] ([diff|phpwiki:?diff=ListeDeCeQuiVaParDouze]) 14:31 ip:62.244.90.86
* [ListeDeCeQuiVaParHuit] ([diff|phpwiki:?diff=ListeDeCeQuiVaParHuit]) 11:14 ip:89.156.27.216
* [ListeDesAnagrammesDesDepartementsFrancais] ([diff|phpwiki:?diff=ListeDesAnagrammesDesDepartementsFrancais]) 08:22 ip:62.244.90.86
* [ListeDeMotsRelatifsAlaPartiePosterieuredesHumains] ([diff|phpwiki:?diff=ListeDeMotsRelatifsAlaPartiePosterieuredesHumains]) 22:51 ip:188.83.181.46
* [ListeDeMotsMasculinsSeTerminantParEtte] ([diff|phpwiki:?diff=ListeDeMotsMasculinsSeTerminantParEtte]) 22:14 ip:78.246.125.150
* [ListeDeContinentsDisparus] ([diff|phpwiki:?diff=ListeDeContinentsDisparus]) 14:50 ip:92.163.118.40
* [ListeDeRuesParisiennesZetMonovocaliques] ([diff|phpwiki:?diff=ListeDeRuesParisiennesZetMonovocaliques]) 14:57 ip:82.245.153.54
* [ListeDeParPitieNeMettezPasDeLiensVers] ([diff|phpwiki:?diff=ListeDeParPitieNeMettezPasDeLiensVers]) 12:10 ip:78.235.123.18
* [ListeDePlanetesEtAutresCorpsCelestesPhotographiesDePresParDesEnginsSpatiaux] ([diff|phpwiki:?diff=ListeDePlanetesEtAutresCorpsCelestesPhotographiesDePresParDesEnginsSpatiaux]) 10:29 ip:82.121.37.205
* [ListeDePontDeParis] ([diff|phpwiki:?diff=ListeDePontDeParis]) 06:58 ip:82.121.165.228
* [ListedeRepliquesEtRepartiesCinglantes] ([diff|phpwiki:?diff=ListedeRepliquesEtRepartiesCinglantes]) 06:56 ip:82.121.165.228
* [ListeDeGentillessesEcritesParCertainsWikistes] ([diff|phpwiki:?diff=ListeDeGentillessesEcritesParCertainsWikistes]) 20:55 ip:82.121.162.70
* [ListeDeDisparus] ([diff|phpwiki:?diff=ListeDeDisparus]) 07:18 ip:83.114.74.97
* [ListeDesListesSponsoriseesParLeSmClubDeBrieComteRobert] ([diff|phpwiki:?diff=ListeDesListesSponsoriseesParLeSmClubDeBrieComteRobert]) 06:51 ip:82.121.42.25
* [ListeDeFilmsPortantUnTitreEnAnglaisChangePourLaFranceParUnAutreTitreEnAnglais] ([diff|phpwiki:?diff=ListeDeFilmsPortantUnTitreEnAnglaisChangePourLaFranceParUnAutreTitreEnAnglais]) 15:09 ip:94.225.179.4
* [ListeDesChosesQuinappartiennentquaMoi] ([diff|phpwiki:?diff=ListeDesChosesQuinappartiennentquaMoi]) 22:05 ip:93.4.158.213
* [ListeDeLivresEtDeFilmsQuiParlentDuSuicide] ([diff|phpwiki:?diff=ListeDeLivresEtDeFilmsQuiParlentDuSuicide]) 17:40 ip:92.132.91.57
* [ListeDalexandrinsFinissantParLeSonUle] ([diff|phpwiki:?diff=ListeDalexandrinsFinissantParLeSonUle]) 11:32 ip:152.77.24.34
* [ListeDesBandessineesParodiques] ([diff|phpwiki:?diff=ListeDesBandessineesParodiques]) 11:01 ip:94.109.62.96
* [ListeDePartisTunisiens] ([diff|phpwiki:?diff=ListeDePartisTunisiens]) 16:34 ip:80.15.165.37
* [ListeDeParDieu] ([diff|phpwiki:?diff=ListeDeParDieu]) 19:37 ip:86.199.101.199
* [ListeDeMotsQuiVeulentParfoisDireAutreChoseQueCeQuonPense] ([diff|phpwiki:?diff=ListeDeMotsQuiVeulentParfoisDireAutreChoseQueCeQuonPense]) 16:20 ip:83.114.202.61
* [ListeDesInventionsNonPrevuesParLesAuteursdeScienceFiction] ([diff|phpwiki:?diff=ListeDesInventionsNonPrevuesParLesAuteursdeScienceFiction]) 15:43 ip:83.114.202.61
* [ListedEthylophilesCelebresetDisparus] ([diff|phpwiki:?diff=ListedEthylophilesCelebresetDisparus]) 19:11 ip:82.121.171.192
* [ListeDeNomsPropresEtCommunsSeTerminantParUnQq] ([diff|phpwiki:?diff=ListeDeNomsPropresEtCommunsSeTerminantParUnQq]) 15:31 ip:82.231.215.50
* [ListeDeParticulesElementaires] ([diff|phpwiki:?diff=ListeDeParticulesElementaires]) 21:48 ip:109.16.23.154
* [ListedesNombresEntiersNaturelsClassesParOrdreAlphabetique] ([diff|phpwiki:?diff=ListedesNombresEntiersNaturelsClassesParOrdreAlphabetique]) 19:05 ip:90.30.106.94
* [ListeDesInventionsRealiseesParDesNoirs] ([diff|phpwiki:?diff=ListeDesInventionsRealiseesParDesNoirs]) 22:05 ip:178.195.147.170
* [ListeDeprenomdestarfemininefinissantpara] ([diff|phpwiki:?diff=ListeDeprenomdestarfemininefinissantpara]) 18:55 ip:90.9.133.128
* [ListedEpressionsContenantLeMotParole] ([diff|phpwiki:?diff=ListedEpressionsContenantLeMotParole]) 18:30 ip:93.6.248.176
* [ListeDesDepartementsFrancais] ([diff|phpwiki:?diff=ListeDesDepartementsFrancais]) 19:14 ip:90.58.201.154
* [ListeDeChosesRepugnantesQuiCommencentParLaSeiziemeLettre] ([diff|phpwiki:?diff=ListeDeChosesRepugnantesQuiCommencentParLaSeiziemeLettre]) 18:21 ip:82.121.35.254
* [ListeDePlaquesCommemorativesParisiennes] ([diff|phpwiki:?diff=ListeDePlaquesCommemorativesParisiennes]) 17:41 ip:88.174.43.190
* [ListeDeMesAventuresAnecdotiquesDansLesRuesDeParis] ([diff|phpwiki:?diff=ListeDeMesAventuresAnecdotiquesDansLesRuesDeParis]) 13:33 ip:82.67.211.63
* [ListedeParasites] ([diff|phpwiki:?diff=ListedeParasites]) 21:11 ip:82.121.45.95
* [ListeDesExpressionsCommencantsEtFinissantParUnHomonyme] ([diff|phpwiki:?diff=ListeDesExpressionsCommencantsEtFinissantParUnHomonyme]) 14:24 ip:90.44.104.122
* [ListeDeMotsQuiFinissentPar] ([diff|phpwiki:?diff=ListeDeMotsQuiFinissentPar]) 09:56 ip:83.114.200.202
* [ListeDeParonomases] ([diff|phpwiki:?diff=ListeDeParonomases]) 21:49 ip:82.121.163.250
* [ListeDeMotsQuiFinissentParAne] ([diff|phpwiki:?diff=ListeDeMotsQuiFinissentParAne]) 19:28 ip:90.2.99.83
* [ListeDesAdressesDeMesBureauxParisiens] ([diff|phpwiki:?diff=ListeDesAdressesDeMesBureauxParisiens]) 21:31 ip:83.114.204.104
* [ListeDesNormesParisiennesPourLesLargeursDesVoiesDeCirculationEtDeStationnement] ([diff|phpwiki:?diff=ListeDesNormesParisiennesPourLesLargeursDesVoiesDeCirculationEtDeStationnement]) 21:30 ip:83.114.204.104
* [ListeDeSallesDeConcertsParisiennes] ([diff|phpwiki:?diff=ListeDeSallesDeConcertsParisiennes]) 21:29 ip:83.114.204.104
* [ListeDeLignesDeMetroParisiensQuiTraversentDeuxFoisLaSeine] ([diff|phpwiki:?diff=ListeDeLignesDeMetroParisiensQuiTraversentDeuxFoisLaSeine]) 21:20 ip:83.114.204.104
* [ListedeslignesdAutobusparisiensayantdisparu] ([diff|phpwiki:?diff=ListedeslignesdAutobusparisiensayantdisparu]) 19:34 ip:83.114.204.104
* [ListeDeListesQuiParlentUnPeuDeParis] ([diff|phpwiki:?diff=ListeDeListesQuiParlentUnPeuDeParis]) 19:32 ip:83.114.204.104
* [ListedEminencesParisiennes] ([diff|phpwiki:?diff=ListedEminencesParisiennes]) 19:29 ip:83.114.204.104
* [ListeDesRueDeParisQuiComportentUnNombreDansLeurNom] ([diff|phpwiki:?diff=ListeDesRueDeParisQuiComportentUnNombreDansLeurNom]) 19:26 ip:83.114.204.104
* [ListeDesMaisonsDeParisDansLesPagesJaunes] ([diff|phpwiki:?diff=ListeDesMaisonsDeParisDansLesPagesJaunes]) 19:26 ip:83.114.204.104
* [ListeDesMonumentsDeParis] ([diff|phpwiki:?diff=ListeDesMonumentsDeParis]) 18:46 ip:83.114.204.104
* [ListeDeMotsUtilisesParLesPartisTunisiens] ([diff|phpwiki:?diff=ListeDeMotsUtilisesParLesPartisTunisiens]) 17:54 ip:83.204.218.69
* [ListeDesLunesDeSaturnePhotographieesParLaSondeCassini] ([diff|phpwiki:?diff=ListeDesLunesDeSaturnePhotographieesParLaSondeCassini]) 18:12 ip:83.114.76.65
* [ListedAnimauxQuiParlentDansLesBandesDessinees] ([diff|phpwiki:?diff=ListedAnimauxQuiParlentDansLesBandesDessinees]) 16:28 ip:83.204.218.69
* [ListeDeListesLanceesParJeg] ([diff|phpwiki:?diff=ListeDeListesLanceesParJeg]) 01:48 ip:78.235.123.18
* [ListeDesRepresentationsduJugementDeParis] ([diff|phpwiki:?diff=ListeDesRepresentationsduJugementDeParis]) 18:48 ip:83.114.73.225
* [ListeDeParolesDeChirurgiensFacetieux] ([diff|phpwiki:?diff=ListeDeParolesDeChirurgiensFacetieux]) 22:18 ip:78.192.14.229
* [ListeDeMortsAbattusParDesChasseurs] ([diff|phpwiki:?diff=ListeDeMortsAbattusParDesChasseurs]) 14:57 ip:82.224.178.7
* [ListeDeDepartementsFrancaisImagin...] ([diff|phpwiki:?diff=ListeDeDepartementsFrancaisImagin...]) 03:30 ip:83.204.134.30
* [ListeDesInstructionsExecuteesParLaServeuseVirtuelle] ([diff|phpwiki:?diff=ListeDesInstructionsExecuteesParLaServeuseVirtuelle]) 16:06 ip:83.114.199.168
* [ListeDeTotologieParNonoOuBrevesDeComptoir] ([diff|phpwiki:?diff=ListeDeTotologieParNonoOuBrevesDeComptoir]) 19:32 ip:82.121.174.228
* [ListeDeParolesDeChansonsDeJohnnyHallyday] ([diff|phpwiki:?diff=ListeDeParolesDeChansonsDeJohnnyHallyday]) 11:39 ip:78.235.123.18
* [ListeDeMotsFinissantParAne] ([diff|phpwiki:?diff=ListeDeMotsFinissantParAne]) 19:01 ip:82.121.32.160
* [ListeDenomsterminesparise] ([diff|phpwiki:?diff=ListeDenomsterminesparise]) 22:51 ip:86.217.55.42
* [ListeDesMomentsParfaitsDeLaJourneePourUnHomme] ([diff|phpwiki:?diff=ListeDesMomentsParfaitsDeLaJourneePourUnHomme]) 16:40 ip:82.121.175.245
* [ListeDesMomentsParfaitsDeLaJourneePourUneFemme] ([diff|phpwiki:?diff=ListeDesMomentsParfaitsDeLaJourneePourUneFemme]) 16:33 ip:82.121.175.245
* [ListeDeMotsFinissantParMan] ([diff|phpwiki:?diff=ListeDeMotsFinissantParMan]) 22:38 ip:90.50.142.54
* [ListeDeMotsDePasseAdoresParLesHackers] ([diff|phpwiki:?diff=ListeDeMotsDePasseAdoresParLesHackers]) 19:21 ip:83.114.106.144
* [ListeDuParapluie] ([diff|phpwiki:?diff=ListeDuParapluie]) 19:16 ip:82.121.161.231
* [ListedAppareilsQuiDonnentlHeureSansQuOnLeurAitDemande] ([diff|phpwiki:?diff=ListedAppareilsQuiDonnentlHeureSansQuOnLeurAitDemande]) 14:50 ip:90.50.12.54
* [ListeDeMachinesDisparuesOuEnVoieDeDisparition] ([diff|phpwiki:?diff=ListeDeMachinesDisparuesOuEnVoieDeDisparition]) 06:13 ip:83.114.197.187
* [ListeDeParadoxes] ([diff|phpwiki:?diff=ListeDeParadoxes]) 19:20 ip:83.114.197.187
* [ListeDeGensOuDeChosesQuiVontParDeux] ([diff|phpwiki:?diff=ListeDeGensOuDeChosesQuiVontParDeux]) 07:28 ip:83.114.70.131
* [ListeDeParlerThai] ([diff|phpwiki:?diff=ListeDeParlerThai]) 18:28 ip:86.218.78.182
* [ListeDeCommentairesOnLineDunePartiedEchecs] ([diff|phpwiki:?diff=ListeDeCommentairesOnLineDunePartiedEchecs]) 20:16 ip:83.114.77.150
* [ListeDePhrasesJamaisPrononceesParNapoleon] ([diff|phpwiki:?diff=ListeDePhrasesJamaisPrononceesParNapoleon]) 18:46 ip:86.218.14.121
* [ListeParesseuse] ([diff|phpwiki:?diff=ListeParesseuse]) 08:22 ip:83.114.66.156
* [ListeDeMerciPourLesChainesQuiCirculentParLeCourrierElectronique] ([diff|phpwiki:?diff=ListeDeMerciPourLesChainesQuiCirculentParLeCourrierElectronique]) 22:30 ip:82.121.164.213
* [ListeDeCenestPasParceQueJeFaisCaQueJeSuisUneBarbie] ([diff|phpwiki:?diff=ListeDeCenestPasParceQueJeFaisCaQueJeSuisUneBarbie]) 06:23 ip:86.218.76.62
* [ListedeNomsdeFemmesChanteesenPoesieoudeFemmesaimeespardesPoetes] ([diff|phpwiki:?diff=ListedeNomsdeFemmesChanteesenPoesieoudeFemmesaimeespardesPoetes]) 19:50 ip:82.121.167.1
* [ListeLePrintempsEstArrivePar] ([diff|phpwiki:?diff=ListeLePrintempsEstArrivePar]) 19:06 ip:212.234.218.194
* [ListeEnVracEtParPetitesSalvesDeMotsQueVousAimezAimer] ([diff|phpwiki:?diff=ListeEnVracEtParPetitesSalvesDeMotsQueVousAimezAimer]) 18:40 ip:79.89.138.156
* [ListeDeMotsCommencantParCou] ([diff|phpwiki:?diff=ListeDeMotsCommencantParCou]) 19:19 ip:189.100.88.249
* [ListedenomsdedomaineinterditsparlAfnic] ([diff|phpwiki:?diff=ListedenomsdedomaineinterditsparlAfnic]) 17:11 ip:83.114.78.22
* [ListeQueDeParceQue] ([diff|phpwiki:?diff=ListeQueDeParceQue]) 16:56 ip:83.114.67.161
* [ListeDeCequilFautPasOublierDeRendreQuandOnPartAlaRetraite] ([diff|phpwiki:?diff=ListeDeCequilFautPasOublierDeRendreQuandOnPartAlaRetraite]) 12:49 ip:81.51.94.86
* [ListeDesOperationsChirurgicalesQueJaiSubiesEtDontPlusPersonneNeVeutEntendreParler] ([diff|phpwiki:?diff=ListeDesOperationsChirurgicalesQueJaiSubiesEtDontPlusPersonneNeVeutEntendreParler]) 23:27 ip:81.51.223.19
* [ListeDeSortesDeMetaplasmesParEpenthese] ([diff|phpwiki:?diff=ListeDeSortesDeMetaplasmesParEpenthese]) 15:28 ip:82.228.67.225
* [ListeDeChosesEtrangesConstateesParDesObservateursImpartiauxAlaFrontiereItaloEspagnole] ([diff|phpwiki:?diff=ListeDeChosesEtrangesConstateesParDesObservateursImpartiauxAlaFrontiereItaloEspagnole]) 20:31 ip:83.134.2.34
* [ListeDesCommunesRenommeesParLaRevolutionFrancaise] ([diff|phpwiki:?diff=ListeDesCommunesRenommeesParLaRevolutionFrancaise]) 20:54 ip:83.134.2.34
* [ListeDeMotsQuiFinissentParIa] ([diff|phpwiki:?diff=ListeDeMotsQuiFinissentParIa]) 10:35 ip:90.50.140.177
* [ListeDeChosesAfaireAvantDePartirEnVacances] ([diff|phpwiki:?diff=ListeDeChosesAfaireAvantDePartirEnVacances]) 22:12 ip:83.203.242.188
* [ListeDeMotsSinguliersFinissantPars] ([diff|phpwiki:?diff=ListeDeMotsSinguliersFinissantPars]) 18:49 ip:82.121.164.7
* [ListeDesMotsSinguliersFinissantParAux] ([diff|phpwiki:?diff=ListeDesMotsSinguliersFinissantParAux]) 18:48 ip:82.121.164.7
* [ListeDeListesIntouchablesGardeesParUnCerbereDepourvuDeToleranceEtdHumour] ([diff|phpwiki:?diff=ListeDeListesIntouchablesGardeesParUnCerbereDepourvuDeToleranceEtdHumour]) 20:20 ip:83.114.202.119
* [ListeDesAssociationsEvoqueesParSaturneaHenryMiller] ([diff|phpwiki:?diff=ListeDesAssociationsEvoqueesParSaturneaHenryMiller]) 11:20 ip:91.168.123.170
* [ListeDeDepartementsAyantChangeDeNom] ([diff|phpwiki:?diff=ListeDeDepartementsAyantChangeDeNom]) 17:32 ip:79.95.247.236
* [ListeDeDepartementsFrancaisImaginaires] ([diff|phpwiki:?diff=ListeDeDepartementsFrancaisImaginaires]) 17:15 ip:79.95.247.236
* [ListeDeJeDemandePardonAuNomDeLaFrance] ([diff|phpwiki:?diff=ListeDeJeDemandePardonAuNomDeLaFrance]) 23:46 ip:90.2.111.107
* [ListeDeNomsQuiNeFontPasPartieDesAventuresdAsterixLeGaulois] ([diff|phpwiki:?diff=ListeDeNomsQuiNeFontPasPartieDesAventuresdAsterixLeGaulois]) 13:35 ip:189.107.187.151
* [ListeDartistesAyantParticipesAuFestivalDeWoodstockEnSixtyNine] ([diff|phpwiki:?diff=ListeDartistesAyantParticipesAuFestivalDeWoodstockEnSixtyNine]) 07:09 ip:82.66.147.32
* [ListeDesMonumentsDeParisQuiNeRetournePasUnWikiError] ([diff|phpwiki:?diff=ListeDesMonumentsDeParisQuiNeRetournePasUnWikiError]) 06:55 ip:82.121.32.63
* [LisiteDeParolesActesOuEvenementsPouvantEntrainerRuptureOuFacherie] ([diff|phpwiki:?diff=LisiteDeParolesActesOuEvenementsPouvantEntrainerRuptureOuFacherie]) 23:31 ip:189.107.187.151
* [ListeDeMotsRendusCelebresParLesMedias] ([diff|phpwiki:?diff=ListeDeMotsRendusCelebresParLesMedias]) 18:48 ip:189.107.187.151
* [ListeDesMotsQuiFinissentParEsque] ([diff|phpwiki:?diff=ListeDesMotsQuiFinissentParEsque]) 15:45 ip:189.107.187.151
* [ListePourParlerAmericain] ([diff|phpwiki:?diff=ListePourParlerAmericain]) 01:59 ip:189.107.187.151
* [ListeDinjonctionsparentales] ([diff|phpwiki:?diff=ListeDinjonctionsparentales]) 14:55 ip:194.3.134.254
* [ListeDeNouveauxPartis] ([diff|phpwiki:?diff=ListeDeNouveauxPartis]) 20:07 ip:189.107.172.59
* [ListeDeChosesQuiLeDevraientMaisQuiSontPasPareilles] ([diff|phpwiki:?diff=ListeDeChosesQuiLeDevraientMaisQuiSontPasPareilles]) 12:44 ip:90.30.55.92
* [ListeDeCoupsDePartiesDechecsAjouerIciEntreAmateurs] ([diff|phpwiki:?diff=ListeDeCoupsDePartiesDechecsAjouerIciEntreAmateurs]) 12:16 ip:90.30.55.92
* [ListeDeParolesDeChansonsDe] ([diff|phpwiki:?diff=ListeDeParolesDeChansonsDe]) 01:14 ip:84.226.100.59
* [ListePourNePlusParlerCommeDesRacailles] ([diff|phpwiki:?diff=ListePourNePlusParlerCommeDesRacailles]) 19:32 ip:83.114.203.79
* [ListeDeListesSpameesAreparerdUrgence] ([diff|phpwiki:?diff=ListeDeListesSpameesAreparerdUrgence]) 20:32 ip:77.203.11.14
* [ListeExperimentaleEtSuccinteDuParlerPagOlak] ([diff|phpwiki:?diff=ListeExperimentaleEtSuccinteDuParlerPagOlak]) 17:34 ip:212.234.218.194
* [ListeDesLupinonymesNomsdEmpruntEtIdentitesUsurpeesParleGentlemanCambrioleur] ([diff|phpwiki:?diff=ListeDesLupinonymesNomsdEmpruntEtIdentitesUsurpeesParleGentlemanCambrioleur]) 16:42 ip:83.145.100.34
* [ListeDeCaracteristiquesComparativesDuChinchard] ([diff|phpwiki:?diff=ListeDeCaracteristiquesComparativesDuChinchard]) 16:40 ip:83.145.100.34
* [listedescaracteristiquesdelachosecapabledecompenserlesdommagesoccasionnesparmarencontreaveckent] (new) 09:21 ip:122.221.10.234
* [ListeDeMotsfinissantparEnt] (new) 08:54 ip:93.93.98.2
* [ListeDuParlerParalloidre] ([diff|phpwiki:?diff=ListeDuParlerParalloidre]) 22:01 ip:41.209.156.35
* [ListedesSeriesTeledontlaBandeSonMeTrotteEncoreparlaTete] ([diff|phpwiki:?diff=ListedesSeriesTeledontlaBandeSonMeTrotteEncoreparlaTete]) 11:52 ip:77.202.225.73
* [ListeIllustreeDeTesParentsDeVincentDelerm] ([diff|phpwiki:?diff=ListeIllustreeDeTesParentsDeVincentDelerm]) 23:02 ip:90.27.30.25
* [ListeDeGuepards] ([diff|phpwiki:?diff=ListeDeGuepards]) 19:22 ip:84.226.235.219
* [ListeDeChosesTellementUniquesQuEllesNeFontPartieDaucuneListe] ([diff|phpwiki:?diff=ListeDeChosesTellementUniquesQuEllesNeFontPartieDaucuneListe]) 11:49 ip:212.180.5.217
* [ListeDeMotsFinissantparPhobe] ([diff|phpwiki:?diff=ListeDeMotsFinissantparPhobe]) 15:24 ip:82.121.173.251
* [ListeDeListesDisparuesEnJanvier] ([diff|phpwiki:?diff=ListeDeListesDisparuesEnJanvier]) 16:47 ip:86.218.14.132
* [ListeDeMotsTerminantParEque] ([diff|phpwiki:?diff=ListeDeMotsTerminantParEque]) 12:04 ip:212.234.218.194
* [ListePourComparerLesHommes] ([diff|phpwiki:?diff=ListePourComparerLesHommes]) 14:40 ip:165.72.200.11
* [ListeOfficielleDuPartiDesOurs] ([diff|phpwiki:?diff=ListeOfficielleDuPartiDesOurs]) 21:49 ip:83.112.201.168
* [ListededisparitioNs] ([diff|phpwiki:?diff=ListededisparitioNs]) 20:21 ip:77.203.54.110
* [ListeElectoraleDeParisCinquieme] ([diff|phpwiki:?diff=ListeElectoraleDeParisCinquieme]) 09:42 ip:83.114.196.152
* [ListeDeSynonymesDuDesordreClassesParOrdreAlphabetique] ([diff|phpwiki:?diff=ListeDeSynonymesDuDesordreClassesParOrdreAlphabetique]) 17:56 ip:212.234.218.194
* [ListeDesRaisonsPourLesquellesListeDeBoutonsEstEnTeteDuHitParad] ([diff|phpwiki:?diff=ListeDesRaisonsPourLesquellesListeDeBoutonsEstEnTeteDuHitParad]) 17:53 ip:83.114.75.44
* [ListeDeListesEnregistreesSansModificationsMaisConsidereesCommeModifieesParLeWiki] ([diff|phpwiki:?diff=ListeDeListesEnregistreesSansModificationsMaisConsidereesCommeModifieesParLeWiki]) 23:50 ip:83.179.177.122
* [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeMo] ([diff|phpwiki:?diff=ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeMo]) 18:08 ip:82.121.171.243
* [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifiees] (new) 17:06 ip:80.118.33.228
* [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifieesParLeWiki] (new) 17:03 ip:80.118.33.228
* [ListeDeJeuxDeMotsCochonsGeneresParProgramme] ([diff|phpwiki:?diff=ListeDeJeuxDeMotsCochonsGeneresParProgramme]) 20:58 ip:83.114.72.72
* [ListeInventaireDuMinimumNecessairePourPartirEnExploration] ([diff|phpwiki:?diff=ListeInventaireDuMinimumNecessairePourPartirEnExploration]) 16:37 ip:195.6.25.117
* [ListeQuestionnaireDeBandeApart] ([diff|phpwiki:?diff=ListeQuestionnaireDeBandeApart]) 23:12 ip:86.212.3.135
* [ListDelafoliequisemparedesgensquidoivereviserleurbacetquisamusesurlessitesbizarres] ([diff|phpwiki:?diff=ListDelafoliequisemparedesgensquidoivereviserleurbacetquisamusesurlessitesbizarres]) 18:38 ip:82.126.223.72
* [ListedeVinsRougesDontLeNomCommencentParChateau] ([diff|phpwiki:?diff=ListedeVinsRougesDontLeNomCommencentParChateau]) 12:41 ip:86.209.202.248
* [ListedExpressionsgeneralementincomprisesparceuxquilesUtilisent] ([diff|phpwiki:?diff=ListedExpressionsgeneralementincomprisesparceuxquilesUtilisent]) 19:36 ip:83.145.120.251
* [ListeinfiniedenosGoutsCommunscreeparlaMagiedelaTelepathieetquininterressequenous] ([diff|phpwiki:?diff=ListeinfiniedenosGoutsCommunscreeparlaMagiedelaTelepathieetquininterressequenous]) 21:27 ip:172.185.62.124
* [ListeDesCaracteristiquesDeLaChoseCapableDeCompenserLesDommagesOccasionnesParMaRencontreAvecKent] ([diff|phpwiki:?diff=ListeDesCaracteristiquesDeLaChoseCapableDeCompenserLesDommagesOccasionnesParMaRencontreAvecKent]) 22:59 ip:90.30.63.66
* [ListeInfinieDeNosGoutsCommunsCreeParLaMagieDeLa] ([diff|phpwiki:?diff=ListeInfinieDeNosGoutsCommunsCreeParLaMagieDeLa]) 21:42 ip:172.204.230.28
* [ListedesEtatsdesEtatsUnisparfaitementrectangulaires] ([diff|phpwiki:?diff=ListedesEtatsdesEtatsUnisparfaitementrectangulaires]) 21:06 ip:82.66.147.32
* [ListeDesVillesRenommeesParLaRevolutionFrancaise] ([diff|phpwiki:?diff=ListeDesVillesRenommeesParLaRevolutionFrancaise]) 12:55 ip:82.121.43.45
* [ListeDeMotsCommencantParAne] ([diff|phpwiki:?diff=ListeDeMotsCommencantParAne]) 19:23 ip:82.127.31.125
* [ListeDeNouvellesParutions] ([diff|phpwiki:?diff=ListeDeNouvellesParutions]) 23:53 ip:193.249.228.112
* [ListeDeJeuxDeMotsGeneresParProgramme] ([diff|phpwiki:?diff=ListeDeJeuxDeMotsGeneresParProgramme]) 00:43 ip:62.147.11.144
* [ListeDeLivresQuiParlentDeJe] ([diff|phpwiki:?diff=ListeDeLivresQuiParlentDeJe]) 15:05 ip:195.93.102.6
* [HitParade] ([diff|phpwiki:?diff=HitParade]) 20:19 ip:86.218.75.156
* [listedemotsfinissantparane] (new) 05:23 ip:70.189.67.56
* [listedelivresetdefilmsquiparlentdusuicide] (new) 05:21 ip:70.189.67.56
* [listedechansonsauxparolestrompeuses] (new) 05:17 ip:200.118.2.220
* [ListeDesObjetsVendusParJessica] ([diff|phpwiki:?diff=ListeDesObjetsVendusParJessica]) 17:22 ip:212.234.218.193
* [ListeDeMotsFinissantParIte] (new) 17:35 ip:205.236.3.72
* [ListeDeMotsCommencantOuFinissantParAn] ([diff|phpwiki:?diff=ListeDeMotsCommencantOuFinissantParAn]) 20:28 ip:83.114.200.228
ListedeLisezMoi
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
µµproposée par A. (''"Avec des listeurs,faire une liste de livres qu'on découvre et qu'on a envie que les autres découvrent aussi."''µµ
ListedeNouveauxElementsPeriodiques
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* n° 145 : l'érébium (Eb), décrit par A.Allais
ListeDeGraphes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeMnemotechnique
/* par PITIE n'oubliez rien ! merci
%%Center(µµLes "clefs" sont dans la partie inférieure de cette listeµµ)%%
#Le %%Red(premier)%% croissant est visible dans la %%Red(première)%% partie de la nuit, le %%Green(dernier)%% croissant est visible dans la %%Green(dernière)%% partie de la nuit.
**µµ(on peut remplacer les poulets par des phoques, des poireaux, des pommes, des poires, des patates ou n'importe quoi qui commence par P et qui se mange)µµ
* Allo Bonaparte Coca-Cola Docile Et Farandole Gondole Hystérique Ici Jiromoto Korridor Limonade Moto Noé Ostrogoth Philosophie Quoquoriquo Ramoneur Salade Thon Ultrason Végétation Wagons-hauts oXydation Yolimoto Zoroastre
# ...par contre pourrir en prend 2 et courir n'en prend qu'un...
# µµindiqué par soucis d'exhaustivitéµµ
# ''Pas de commentaire, juste une précision : si les correcteurs des traitements de texte ne corrigent pas quand il n'y a qu'un seul M, c'est que l'autre mot existe, (l'action d'évider)'' -- µµpar ailleurs, si la personne ne met qu'un M à emmerdement, le truc ne l'aidera pas beaucoup, ''évidemment...''µµ
# ** Mnémonique des sept couleurs du spectre données par Isaac Newton, dans l’ordre de la plus petite à la la plus grande longueur d’onde : violet, indigo, bleu, vert, jaune, orange et rouge. (arc-en-ciel)[http://www.clg-camus-bois-colombes.ac-versailles.fr/Vie%20des%20classes%202005/Lumi%e8re/arc%20en%20ciel/image%20arc-en-ciel%204.jpg]
** Il y en avait une plus trapue, avec "la cousine du sycomore, etc.", pour retenir cos(a+b) et les autres, mais, même avec Google, je ne parviens à la retrouver. Un savant lecteur saura-t-il nous éclairer ?
# Prolongez d'un trait virtuel la limite intérieure visible de la lune, si vous obtenez un __p__ c'est le premier quartier, si vous obtenez un __d__ c'est le dernier quartier µµ-ce n'est vrai que dans l'hémisphère nord, et pratiquement à partir du tropique du Cancerµµ
** autre méthode : (en considérant la limite extérieure) première ou dernière partie d'un X [http://kosmopolis.free.fr/kosmopolis/systemesolaire/stl/presentationlune/premierquartier.jpg]
** Les phrases du 2ème paragraphes ne sont pas satisfaisantes, ne permettant pas d'éviter la confusion de place entre Mercure et Mars
# Vous confondez les pays baltes sur la carte ? C'est tout simple, ils sont placés par ordre alphabétique de haut en bas...
# Par ordre alphabétique du Nord au Sud
# Cambrien, Ordovicien, Silurien, Dévonien, Carbonifère, Permien : les 6 périodes de l'ère primaire par ordre chronologique
# Trias, Jurassique, Crétacé : les 3 périodes de l'ère secondaire par ordre chronologique
# Paléogène, Eocène, Oligocène, Miocène, Pliocène) : les 5 périodes de l'ère tertiaire par ordre chronologique
# Pour se souvenir du nom des trois parques : Clotho, Lachésis et Atropos
# L'échelle d'électronégativité (par ordre décroissant)
* Méthode simple (!!??) pour apprendre le morse : il suffit de retenir ces mots qui correspondent à chacune des lettres de l'alphabet. Pour restituer le code de la lettre correspondante, vous divisez le mot en syllabes : toutes les syllabes qui contiennent o (la lettre ou le son) sont remplacées par un signal long et toutes les autres par un court. Exemple pour la lettre P : Phi/Lo/So/Phie = .--.
# Les [7 péchés capitaux| ListedesseptPechesCapitaux] : paresse, orgueil, gourmandise, luxure, avarice, colère, envie.
# Les rois mages : Balthazar, Melchior et Gaspard.
** Fond (se fondre dans le décor), Ombre (se tenir à l'écart), Mouvement (éviter les gestes brusques), Éclat (éviter les éclats lumineux), Couleur (d'où le kaki, camouflage, etc.), et les choses à éviter : Bruit (surtout la nuit), Lueur (feu, etc.), Odeur (repas notamment), Trace (à effacer avant de partir)
*** µµl'hymne à St Jean servait à apprendre le solfège, il avait donc bien au départ une fonction mnémotechnique, la preuve c'est que le nom des notes est resté...µµ
* Ce qui est marrant, c'est que parfois l'astuce est plus compliquée à retenir que la clef...
Liste créée par Shadow (enfin, si je me souviens bien...).
ListeDeCochons
* Heureux les cochons qui occupent toute leur tête à manger, et ne parlent qu'avec la queue ! ''Jules Renard''
* Le cochon n'est devenu sale que par suite de ses fréquentations avec l'homme. A l'état sauvage, c'est un animal très propre. ''Pierre Loti''
* Le cochon offre de nombreux points de comparaison avec un autre mammifère sans poils passé expert dans l’art de semer la merde et de se vautrer dedans. ''P. Desproges''
** Pas Tirlir, le cochon de Taram (et le chaudron magique), mais le nourin de Maître Capello.[http://zoeaparis.typepad.com/photos/uncategorized/2007/08/24/tirelire_cochon.jpg]
* [De l'amour, de l'art ou du cochon ?|http://www.paroles.net/texte/13604]
* Il y a aussi le Pied de cochon à Paris rue Coquillère
**par contre il n'y a pas de Pied de cochon rue des %%Green(Martyrs)%%, mais il ya parfois d'autres petits cochons...
* Le cochon et la prise électrique par Jean de La Fontaine [http://www.villiard.com/images/animaux/cochons/cochon.jpg]
* Le cochonnet au jeu de pétanque [http://www.mairie-montigny.fr/sections/partie_publique/sport/les_associations_spo/la_petanque/downloadFile/photo/petanque.jpg]
* Pig, fumetti italien qui parut en Italie durant 64 numéros sans problèmes particulier, mais dont la traduction française fut interdite en 1988 par le ministre de l'interieur (Pierre Joxe, socialiste)
* Everywhere there's lots of [piggies|http://www.geocities.com/SunsetStrip/Amphitheatre/2557/paroles_thebeatles.html#Piggies] Living piggy lives You can see them out for dinner With their piggy wives Clutching forks and knives to eat their bacon...[http://www.topgame.be/images/t-co-a04.gif]
µµ%%Blue(idée de sol. La cochonne !)%% - reclassée par la Vénus de Miloµµ - Liste spamée le 15/10/07 restaurée sur la base d'une sauvegade du 2/11/2006. Si quelqu'un a plus récent il est le bienvenu !
ListeDesRacontarsArctiquesDeJornRiel
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Ce qu'il advint d'Emma par la suite
__animaux qui sont des personnages à part entière__
ListeDePelles
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Liste créée le 18 juin 2009 par Yann R., en hommage à __la pelle du 18 juin 1940__, mais toutes les autres pelles sont également a-__pellé__ à figurer dans cette liste... __Creusez__ (vos méninges) !... (Mais ne soyez-pas bêcheurs !...)
* __Pelle Erobreren__ (Pelle le conquérant) roman du danois Martin Andersen Nexø publié en 1910, porté à l'écran par le réalisateur, lui-aussi danois, Bille August en 1987. (Palme d'or au Festival de Cannes 1988). [http://ecx.images-amazon.com/images/I/51CECP7EJ1L._SL500_AA240_.jpg]
* Liste créée le 18 juin 2009 par Yann R., en hommage à __la pelle du 18 juin 1940__
ListeDesFinalesDeLaCoupedEuropeDeFootball
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeCeQuiManquePourFaireLesSoldes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* des jets d'eau pour essayer les [parapluies|ListeDuParapluie]
ListeDePratiquesErotiquesChezNosAmisLesBetes
/* par PITIE ne mettez pas de liens vers de GROSSES bestioles en rut. merci
* Les __cerfs__ se sodomisent, le __paresseux__ se masturbe, les __orques__ pratiquent la fellation, les __singes__ partouzent.
* Les __lézards iguanes__ fouettent leur femelles de leur longue queue pour les obliger à partager leur ardeurs amoureuses.
* Buddy et Pedro sont gays. Ils se lavent l'un l'autre, dorment ensemble, prennent leurs repas ensemble... Rien de bien surprenant, si ce n'est que ce sont deux __manchots__ sud-africains du zoo de Toronto. La direction de l'établissement est loin d'être homophobe, mais l'orientation sexuelle des deux individus lui pose un problème, car, l'espèce étant en voie de disparition, elle va devoir essayer de décoller les inséparables pour tenter de les jumeler à des femelles.
* Chez les __antilopes__ topi, ce sont les femelles qui chassent agressivement les mâles pour s'accoupler, un rôle de domination sexuelle inversée par rapport à nombre d'espèces de mammifères.
* On a longtemps cru que les __hyènes__ étaient hermaphrodites. En effet, les femelles ont un clitoris très développé qui ressemble à un pénis et complété par des grandes lèvres gonflées par deux boules graisseuses.
* Mister P. un superbe __paon__ plein de passion amoureuse, passe 18 heures par jour à se pavaner et à faire la roue dans une station-service en Angleterre pour tenter de séduire l'une des pompes à essence µµ(rapporté par la presse britannique.)µµ
* Chez les __grands singes__, dont nous sommes très proches, il existe une forme embryonnaire de prostitution : Les femelles, voyant que les mâles ont de gros besoins sexuels, et que, d'autre part, ils sont d'un piètre secours pour l'éducation des petits (elles les élèvent seules et les mâles n'ont pas de rôle paternel), ont élaboré un système tout simple pour tirer parti de cette conjoncture : Elles cèdent leurs faveurs à ces messieurs en échange de nourriture...
* Des chercheurs ont découvert des couples de __pingouins__ homosexuels dans 16 aquariums et zoos de Tokyo. Ils en ont conclu que les pingouins en captivité "pourraient avoir tendance à former des couples de même sexe" en raison de la difficulté à trouver un partenaire du sexe opposé. Des couples mâles et des couples femelles ont été observés mimant l’acte sexuel. Pour le moment les pingouins se sont refusés à toute déclaration.
* Une fois que le __hamster__ mâle est sexuellement actif, il peut s'accoupler plus de 70 fois en une heure c'est-à-dire plus d'une fois par minute ! En revanche les femelles refusent tout contact dès qu'elles sont fécondées.[http://s1.e-monsite.com/2009/08/30/01/48976105hamster-1-jpg.jpg]
* Une équipe de scientifiques allemands et néo-zélandais pense avoir trouvé la preuve que les __calamars__ s'accouplent au petit bonheur la chance, sans se préoccuper du sexe de leur partenaire.
* Chez les __hyènes__ et chez les __éléphants__ ce sont les femelles qui dominent la horde /*µça me fait penser au parti socialiste...µ
* Chez les __bonobos__, la domination est assurée par les femelles. ''"Le sexe se substitue à l'agressivité. Tant les mâles que les femelles connaissent l'orgasme. Les pratiques sexuelles de ces singes étonnants comprennent des attouchements à deux ou à plus, entre partenaires de sexe opposé ou non, ainsi que le baiser sur la bouche, la masturbation, la fellation et la copulation dans toutes les positions, y compris celle du missionnaire qui est censée être le propre de l'homme..." '''[http://susie.unblog.fr/files/2007/06/tbonobo1.jpg]
* Les __ânesses__ manifestent leur excitation par une écume volubile aux lèvres !
* L'éjaculation se produit dès l'introduction chez le __lapin__ (pauvres lapines) et la plupart des ruminants (pauvres vaches) Par contre l'émission de sperme nécessite plusieurs minutes (jusqu'à 30) chez le __porc__ !
* Être un mammifère ovipare, qui pond des œufs tout en produisant du lait, avoir un drôle de bec de canard aplati, des pattes palmées et le corps recouvert de fourrure ne suffisait pas à l’__ornithorynque__ pour se faire remarquer. Des chercheurs australiens ont découvert plus étonnant encore : cet animal possède cinq paires de chromosomes sexuels, alors que les mammifères ou les oiseaux n’en possèdent qu’une. Lors de la parade nuptiale, l'__ornithorynque__ mâle nage autour de la femelle, puis l'attrape par la queue. (c'est vraiment le monde à l'envers). L'__ornithorynque__ possède un seul orifice pour la reproduction, la ponte des œufs et la défécation. (le cloaque), l'ornithorynque est donc sodomite. Le sexe de l'__ornithorynque__ possède un sexe bifide (avec deux glands), on peut en déduire qu'il pratique également la double pénétration. :-)[http://curieuxdenature.free.fr/photo/orni.GIF]
* L'accouplement du __chien__ et de la chienne dure en moyenne entre 15 et 30 minutes (ben, oui !) Pendant cette période les deux bestioles sont physiquement "soudées" l'un à l'autre, car le pénis du chien est bloqué par l'action des muscles du vagin. Il est dangereux de tenter de les séparer (tirage, frayeur, objet contondant, seau d'eau...) Vous risquez de provoquer une fracture du pénis chez le mâle ou/et une déchirure vaginale chez la femelle !
*La __mante religieuse__ dévore son partenaire alors qu'il parade après l'accouplement (en fait le mâle de la mante religieuse ne peut pas s'accoupler pendant que sa tête est attachée à son corps ? La femelle initie le sexe en arrachant la tête du mâle.)µen réalité la mante religieuse ne bouffe pas systématiquement son partenaire, elle a tout simplement faim après l'acte sexuel; mais comme dans les cages d'observation, elle n'avait que son partenaire à portée de patte, c'est lui qui en faisait les fraisµ
%%Center(µµ --Et pourquoi parade-t-il __après__ et pas __avant__ comme vous et moi, cet imbécile ?µµ)%%
*Le __lion__ : Certains spécimens s'accouplent jusqu'à 50 fois par jour ! idem pour les tigres qui ne sont pas trop regardant sur leur partenaires [http://lemomo2.pagesperso-orange.fr/niknik.jpg]
*La __punaise__ : Chez certaines espèces, le mâle transperce la femelle avec son "pénis-dard", les spermatozoïdes étant véhiculés par le sang.
*Position du castor : se font sucer par les canards, c'est pour ça qu'ils ont la queue plate...
* __Les moustiques__ : µUn sexe vert fluorescent, telle est la nouvelle arme contre le paludisme. Les chercheurs de l’Imperial Collège de Londres ont modifié génétiquement des moustiques pour qu’ils produisent une protéine faisant briller leur sperme et leurs organes génitaux. But de l’opération : repérer les larves mâles et les séparer des femelles, avant de les stériliser par irradiation. Une fois relâchés dans la nature, les mâles transgéniques s’accouplent avec les femelles – mais leurs ébats sont sans descendance. Les femelles ne copulant qu’une fois dans leur courte vie, la population est bientôt décimée. Mais pourquoi choisir de stériliser le sexe fort ? Pour une simple raison : ce sont les femelles qui transmettent le parasite du paludisme. Pour déployer des millions d’éradicateurs dans les zones impaludées, pas question de séparer les sexes à la main. L’automate utilisé par l’équipe londonienne réussit à trier 180 000 larves en dix heures.µ
ListeQuiGlisse
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
** Ou encore: "La pluie de tes insultes glisse sur le parapluie de mon indifférence"
* Un parquet ciré
ListeDeFruitsEtLegumesVenusdAmerique
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListeRouge
/* par PITIE ne mettez pas de liens "verres de GROS rouge". merci
__274__. Evidemment, dire que le mot %%Red(rouge)%%, au lieu qu'il __signifie__ l'intime se rapporterait à l'intime ne nous aide en rien à comprendre sa fonction; mais c'est l'expression psychologiquement la plus marquante pour une certaine expérience particulière au moment de philosopher. C'est comme si lorsque je prononce le mot, je lançais un regard de c?sur ma propre sensation privée pour me dire à moi-même : je sais très bien ce que j'entends par ce mot.%%% %%%
__([LW|mailto:Ludwig.Wittgenstein@philosophyparadise.com])__
* "Amanda portait ? Sancta simplicitas ? un pantalon bouffant d'ottoman incarnat, un ras du cou corail, un caraco purpurin, un obi colcotar, un foulard carmin, un vison nacarat ; bas rubis, gants cramoisis, botillons minium des hauts talons zinzolin." ( La disparition) - [petit lexique perecquien|http://magneb.club.fr/lexperec/plp-accueil.html]
* Les Ballons Rouges - ''[Serge Lama|http://www.paroles.net/chansons/11351.htm]''
* carmin (et par consequent Carmina [Burana|ListeDeBurnes])
* C'est de ta %%Red(bouche)%% que je suis amoureuse, Iokanaan. Ta %%Red(bouche)%% est comme une bande d'écarlate sur une tour d'ivoire. Elle est comme une pomme de grenade coupée par un couteau d'ivoire. Les fleurs de grenade qui fleurissent dans les jardins de Tyr et sont plus %%Red(rouges)%% que les roses, ne sont pas aussi %%Red(rouges)%%. Les cris %%Red(rouges)%% des trompettes qui annoncent l'arrivée des rois, et font peur à l'ennemi ne sont pas aussi %%Red(rouges)%%. Ta %%Red(bouche)%% est plus %%Red(rouge)%% que les pieds de ceux qui foulent le vin dans les pressoirs. Elle est plus %%Red(rouge)%% que les pieds des colombes qui demeurent dans les temples et sont nourries par les prêtres. Elle est plus %%Red(rouge)%% que les pieds de celui qui revient d'une forêt, a tué un lion et vu des tigres dorés. Ta %%Red(bouche)%% est comme une branche de corail que des pêcheurs ont trouvée dans le crépuscule de la mer et qu'ils réservent pour les rois ! Elle est comme le vermillon que les Moa[bites|ListeDeBite] trouvent dans les mines de Moab et que les rois leur prennent. Elle est comme l'arc du roi des Perses qui est peint avec du vermillon et qui a des cornes de corail. Il n'y a rien au monde d'aussi %%Red(rouge)%% que ta %%Red(bouche)%%. Laisse-moi baiser ta %%Red(bouche)%%. ''(Salomé - Oscar Wilde)'' [http://www.vam.ac.uk/images/image/40881-large.jpg]
* la chanson... de Michel Sardou, [texte|http://www.paroles.net/chansons/21379.htm], dont certains trouvent le texte beau, (car tous les goûts dans la nature.)
* Le créateur ''d'un savoureux site pataphysique consacré aux listes et fréquenté par des amoureux'' saisi par la gloire dans __%%Red(SVM)%%__ sept 2002.
** Thor Hushovd, qui a passé plus de 100 kilomètres en tête de course dans l’étape 17, a été distingué par le jury du prix de la combativité et porte aujourd’hui un dossard rouge. (Tour de France 2009)
** Dans les griffes du Dragon rouge (film de karaté apparemment)
*** [L'art de décapiter le Dragon Rouge|http://www.lirexpress.com/product_info.php?cPath=189_289&products_id=1822&osCsid=e3e35f3c6e7cd51717977199be696d58] (chouette titre, non ? Ca parle en fait ''des menstrues de la femme'' !)
*** Le Dragon Rouge (''"L'art de faire parler les morts, de gagner aux jeux de loterie, etc."'')
*et elle (lui, pardon) [http://pimpandhost.com/media/simple/29830/76023cbcc67a.jpg]
* lanterne ...; le plus illustre : Wim Vansevenant est entré dans l'histoire du Tour puisqu'il est le seul à y être parvenu 3 fois (2006, 2007, 2008).
* Parfum (Le)
__µµ%%Center (Le vin est consommé par les plus grands.)%% µµ__
* Rideau%%%µµComme le rideau derrière Clytemnestre hésitant avant de frapper Agamemnon endormi, par le Baron Pierre-Narcisse GUÉRIN en 1774, visible au Louvres, okcébô.µµ
µµ%%Red(rubicondée par Postman, enrichie et ferrarisée par z'arno et ... pimentée d'une manière sublime ...)%% - Réparation en principe terminée le 5 novembre - restaurée après vandalisme le 6/1/8µµ
ListeDePaix
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
µµCréée par Jack, un certain soir d'hiver, pour elle.-- et on remercie notre sympathique candidat :) µµ
ListeDoeuvresGrivoisesdAuteursReputes
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListePourFaireDuChat
/* par PITIE ne mettez pas de liens vers de GROS CHATS. merci
*9. Ils laissent des poils partout
!Matounymes particuliers
* Gelluck [http://www.bdparadisio.com/chat.gif]
* chas de l'aiguille %%Red(µ''(par lequel on veut faire passer un chameau...)''µ)%%
* [parfum|http://www.katzenart.de/texte/baudel.htm]
%%%µµchâtiée par sol c'est pas parce que c'est moi mais je la trouve géniale cette liste. Pas vous ?µµ %%Blue(µµSiiiiµµ)%%
ListedeWiki
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**L'encyclopédie en Wiki : une mine théorique, où on ne sait pas toujours distinguer le meilleur du pire, ni l'encyclopédique de l'approximation... terrain béni de tous les groupes de pression possibles et imaginables et chasse gardée de quelques censeurs psychorigides le tout alimenté par ceux qui ont le plus de temps à y perdre c'est-à-dire les inactifs incultes le plus souvent. [http://http://lemomo2.pagesperso-orange.fr/cerbere.jpg]
** se voudrait hilarant, mais le niveau est souvent assez consternant. Le site est d'ailleurs abrité par Wikipédia, il devait donc jouer le rôle du bouffon du roi, on est est très loin... [http://www.multik.net/bilder/ptiwuki.gif]
* Le wiki des [métallos|http://metallosmedialab.fse-paris.org/]
ListePourWoodyAllen
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Dieu, dans sa grande clémence, a inventé l'alcool... pour que les femmes moches, aussi, puissent baiser.(repris par Coluche ?)
* Je suis abasourdi par le nombre de personnes qui veulent connaître l’[Univers|ListeDeCitationsCosmiques] alors qu’il est déjà suffisamment difficile de se repérer dans le quartier chinois de New York.
* L'éternité c'est long, surtout vers la fin ''µ(reprise par Woody Allen, mais en fait de Franz Kafka, et reprise également par Desproges?)µ''
* Le sexe sans amour est une expérience vide ; oui, mais parmi les expériences vides, c'est une des meilleures !
* Selon les astronomes modernes, l'espace est limité. Voilà une pensée très réconfortante, particulièrement pour les gens qui ne se rappellent jamais où ils ont mis les choses.
* Si je suis un aussi bon amant aujourd'hui, c'est parce que je me suis longtemps entraîné tout seul !
ListeDeMotsDouxDeMatheux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Passer toute la nuit sur une inconnue sans parvenir à en trouver le système.
µ###''Délires de Chori et GB par une froide nuit de décembre''###µ
ListeDePrenomsDansLesTitresDeChansons
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** et aussi par les Têtes Raides
**Elle part sur les rails des tramways, elle court légère, légère et la pluie lave ses mains (Noir Désir, c'est le cas de le dire...)
**Ça, c'est l'histoire de Melody Nelson, qu'à part moi-même personne n'a jamais pris dans ses bras, ça vous étonne, mais c'est comme ça... (Serge G.)
ListeDeMiraclesOrdinairesEtSousestimes
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Le miracle de la tartine qui tombe du côté non-confituré — car cela arrive, mes frères, en dépit des impies des mécréants et des incrédules (moi qui vous parle… etc.)
*Le miracle de faire comprendre que le paradis on ne le trouve pas en mourant,mais en vivant on peut le trouver ! .
* Le miracle de se souvenir de ce qu’on croyait ne pas savoir du tout (par exemple que l’école des cocottes, est une pièce d’Armont et Gerbidon)
* le miracle que, parmi l’infinité des déviances sexuelles possibles, l’humain ait pu aller chercher cette perversité suprême de l’hétérosexualité monogame. Faut être vraiment,vraiment vicieux !!
* Le miracle qu’il fasse effectivement le temps prévu par la météo la veille (miracle suspect, en cours de discussion à la Cour Internationale des Miracles).
* Le miracle du gars qui promet, et tient parole.
*Le miracle économique (défendu par le précédent, très souvent)
* « Les miraculés de l’autoroute tragique », alignés comme des chinchards dans des gymnases ouverts par la cellule de crise.
ListeDesNouveautes
25/11/13 07:37 [ListeDesListesInitialiseesParJoey]
07/11/13 09:51 [ListeDeCeQuiVaParTreize]
06/11/13 15:22 [ListeDeCeQuiVaParDix]
06/11/13 10:59 [ListeDeCeQuiVaParHuit]
06/11/13 10:25 [ListeDeCeQuiVaParOnze]
05/11/13 15:57 [ListeDeCeQuiVaParNeuf]
05/11/13 08:18 [ListeDesAnagrammesDesDepartementsFrancais]
24/07/13 00:39 [ListeDeRuesParisiennesZetMonovocaliques]
08/04/13 15:17 [ListeDesBandessineesParodiques]
04/01/13 18:49 [ListeDeParDieu]
04/09/12 17:17 [ListeDeCeQuiVaParDouze]
02/06/12 17:51 [ListedEpressionsContenantLeMotParole]
25/04/12 13:06 [ListeDeMesAventuresAnecdotiquesDansLesRuesDeParis]
01/02/12 13:18 [ListeDisparitionRevenentes]
27/01/12 14:25 [ListeDeParticulesElementaires]
25/01/12 14:53 [ListeDeListesQuiParlentUnPeuDeParis]
14/11/11 21:27 [ListeDeProposSurParis]
22/10/11 14:10 [ListeDeMotsUtilisesParLesPartisTunisiens]
22/10/11 14:02 [ListeDePartisTunisiens]
11/07/11 23:51 [ListedObjetsRendusObsoletesParLesOrdinateursLesPortablesEtLesSmartphones]
27/05/11 19:36 [ListeDeMotsFinissantParAne]
01/05/11 09:25 [ListeDeSallesDeConcertsParisiennes]
25/03/11 18:42 [ListeDeParolesDeChansonsDeJohnnyHallyday]
18/11/10 12:59 [ListedAppareilsQuiDonnentlHeureSansQuOnLeurAitDemande]
23/09/10 16:45 [ListeDeParPitieNeMettezPasDeLiensVers]
20/02/10 19:15 [ListeDeMotsCommencantParCou]
22/01/10 18:11 [ListeDeMotsDePasseAdoresParLesHackers]
05/12/09 18:18 [ListeDeCequilFautPasOublierDeRendreQuandOnPartAlaRetraite]
10/10/09 13:23 [ListeDesSupportersDuParisSaintGermain]
11/09/09 19:44 [ListeDeMotsSinguliersFinissantPars]
11/09/09 19:37 [ListeDesMotsSinguliersFinissantParAux]
03/07/09 11:13 [ListeDesAssociationsEvoqueesParSaturneaHenryMiller]
29/05/09 23:43 [ListeDeDepartementsFrancaisImagin...]
21/04/09 01:47 [ListeDeJeDemandePardonAuNomDeLaFrance]
04/04/09 00:51 [ListeDenomsterminesparise]
28/03/09 03:35 [ListeDartistesAyantParticipesAuFestivalDeWoodstockEnSixtyNine]
25/03/09 23:45 [ListeDesMonumentsDeParisQuiNeRetournePasUnWikiError]
23/03/09 05:27 [ListeDesMotsQuiFinissentParEsque]
15/03/09 20:55 [ListeDeMotsQuiFinissentParAne]
07/02/09 06:01 [ListeDeNouveauxPartis]
17/11/08 08:54 [ListeDeMotsfinissantparEnt]
17/11/08 08:41 [ListeDeMotsFinissantParAne]
29/10/08 13:25 [ListeDeMotsQuiFinissentPar]
23/10/08 00:15 [ListeDeNomsQuiNeFontPasPartieDesAventuresdAsterixLeGaulois]
16/10/08 22:56 [ListeDenomsterminesparise]
09/10/08 18:32 [ListeDeTitresSurprenantsParmiLesListesDeCeSite]
09/10/08 15:07 [ListeDeMortsAbattusParDesChasseurs]
20/09/08 11:34 [ListeDePlanetesEtAutresCorpsCelestesPhotographiesDePresParDesEnginsSpatiaux]
04/06/08 10:34 [ListeDeMotsFinissantparPhobe]
15/05/08 11:04 [ListeDeMotsTerminantParEque]
04/05/08 22:48 [ListeDuParlerParalloidre]
14/03/08 15:37 [ListeDeContinentsDisparus]
01/02/08 22:19 [ListeDeChosesTellementUniquesQuEllesNeFontPartieDaucuneListe]
14/01/08 17:18 [ListeDeMotsMasculinsSeTerminantParEtte]
14/01/08 17:09 [ListeDeListesEnregistreesSansModificationsMaisConsidereesCommeModifieesParLeWiki]
14/01/08 17:07 [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifiees]
14/01/08 17:05 [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifiees]
14/01/08 17:03 [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifieesParLeWiki]
14/01/08 17:00 [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifieesParLeWiki]
14/01/08 16:59 [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifieesParLeWiki]
14/01/08 16:56 [ListeDeListesEnregistreesSansModificationsSuiteAdesRecherchesParMoteurInternetMaisConsidereesCommeModifieesParLeWiki]
20/10/07 19:53 [ListeDeMotsfinissantparEnt]
08/09/07 18:50 [ListeDesListesImpulseesParJchrbe]
02/09/07 17:00 [ListeDemotfemininseterminantpart]
14/07/07 06:55 [ListeDactionsOudeParolesQuiVousFeronsPasserPourUnDingue]
26/06/07 15:59 [ListeInventaireDuMinimumNecessairePourPartirEnExploration]
24/06/07 20:31 [ListedExpressionsgeneralementincomprisesparceuxquilesUtilisent]
09/06/07 08:37 [ListeDemotfemininseterminantpart]
24/05/07 15:59 [ListeDinjonctionsparentales]
20/04/07 23:58 [ListeDesExpressionsCommencantsEtFinissantParUnHomonyme]
20/03/07 21:32 [ListeInfinieDeNosGoutsCommunsCreeParLaMagieDeLa]
20/03/07 21:25 [ListeinfiniedenosGoutsCommunscreeparlaMagiedelaTelepathieetquininterressequenous]
03/03/07 19:18 [ListeDeDepartementsFrancaisImagin...]
27/02/07 08:47 [ListePourLaCreationEtlAttributionEnPartieRetroactiveDunPrixNoobelDeLaBoonneActrice]
23/02/07 15:53 [ListeDeVocablesPasTropSympasSeTerminantParAsse]
07/01/07 20:49 [ListedesEtatsdesEtatsUnisparfaitementrectangulaires]
20/12/06 23:47 [ListeDesVillesRenommeesParLaRevolutionFrancaise]
15/12/06 18:10 [ListeDesNormesParisiennesPourLesLargeursDesVoiesDeCirculationEtDeStationnement]
13/12/06 20:16 [ListeDeNouvellesParutions]
06/12/06 00:42 [ListeDeJeuxDeMotsGeneresParProgramme]
06/12/06 00:33 [ListeDeJeuxDeMotsCochonsGeneresParProgramme]
01/12/06 17:39 [ListeDesRueDeParisQuiComportentUnNombreDansLeurNom]
29/11/06 00:44 [ListeDeGensCelebresalimparfaitEtAutresTemps]
28/11/06 16:48 [ListeDesAdressesDeMesBureauxParisiens]
25/09/06 06:25 [ListeDeMotsFinissantParMan]
15/09/06 22:53 [ListeDesOperationsChirurgicalesQueJaiSubiesEtDontPlusPersonneNeVeutEntendreParler]
29/08/06 23:24 [ListeDesCommunesRenommeesParLaRevolutionFrancaise]
29/08/06 22:46 [ListeDesVillesRenommeesParLaRevolutionFrancaise]
15/08/06 18:11 [ListeDesDepartementsFrancais]
15/07/06 21:19 [ListeDeParfumsInsolites]
29/06/06 22:42 [ListedenomsdedomaineinterditsparlAfnic]
28/06/06 22:35 [ListePourComparerLesHommes]
16/06/06 12:50 [ListeDeprenomdestarfemininefinissantpara]
31/05/06 10:48 [ListeDeCenestPasParceQueJeFaisCaQueJeSuisUneBarbie]
30/05/06 22:36 [ListeDeChosesQuiLeDevraientMaisQuiSontPasPareilles]
29/05/06 19:14 [ListeDesRepresentationsduJugementDeParis]
22/04/06 17:21 [ListeDuParapluie]
10/04/06 17:35 [ListeDeMotsFinissantParIte]
07/04/06 13:05 [ListeDeMotsQuiFinissentParAne]
05/04/06 15:01 [ListeDeMotsFinissantParAne]
03/04/06 17:48 [ListeDeMotsCommencantParAne]
27/03/06 11:37 [ListeDeMotsCommencantOuFinissantParAn]
13/03/06 22:17 [ListeDeCommentairesOnLineDunePartiedEchecs]
13/03/06 20:25 [ListeDeParolesDeChirurgiensFacetieux]
26/02/06 16:03 [ListeDeMotsQuiFinissentParIa]
ListeDeMaladiesRares
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDesMonumentsDeParis
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
!%%Center(__Liste des monuments de Paris__)%%
* Club de Go [Dolly Parton & Pierre Desproges|http://www.chez.com/blorer] (Paris XXe)
* École d'Architecture de la Ville de Paris, près du métro "Cambronne"[http://leserged.online.fr/photo/archi96.jpg]
* Grande Arche de la Défense %%Smiley(nono5)%% (justement à la Défense et pas à Paris !! Sinon y a la basilique Saint-Denis, et pourquoi pas les châteaux de la Loire %%Green(- voire le Grand Stade!!!)%%)
* Le 42, rue Fontaine 75009 Paris, 2ème étage où vécu André Breton de 1922 à 1966
* Le Musée de l'érotisme, µµ72, boulevard de Clichy, métro Blancheµµ. Expositions permanentes et temporaires, très intéressant et très prisé des participants de séminaires.
* Librairie de la Compagnie Shakespeare à Paris (37 rue de la Bucherie derrière le Quai de Montebello))
* Maison de Casque d'Or de la rue de la Mare (Paris XXème)
* "Regard" de la rue des Cascades (Paris XX)
* Statue d'Étienne Dolet, place Maubert. Jamais remise depuis la guerre. On pouvait encore dans les années 70 voir le socle. Mais depuis, le socle lui-même a été enlevé. µ("Si je dis qu'à Paris la statue d'Étienne Dolet, place Maubert, m'a toujours tout ensemble attiré et causé un insupportable malaise..." A.Breton)µ [http://leserged.online.fr/img/dolet.jpg]
** Et celles d'Oscar Wilde, de Parmentier, de Bashung
* Tour Montparnasse µµ%%Green(- le seul endroit d'où l'on ne voit pas la Tour Montparnasse)%%µµ -- µµau fond d'un caveau du cimetière du Père Lachaise conviendrait égalementµµ
*ListeDeListesQuiParlentUnPeuDeParis
ListeDeRemarquesCommeCaEnPassant
* Pourquoi quand je consulte une carte routière, l'endroit où je veux aller est toujours caché dans un pli... pareil quand je regarde une femme d'ailleurs.
** C'est sans doute parce que vous avez envie d'aller Pilatrer dans les Roziers
*J'aime bien ces historiens qui nous pondent des articles pour nous expliquer que le droit de cuissage n'a jamais existé, ([ici par exemple|http://www.yrub.com/histoire/mensongecuissage.htm]). Au lieu de consulter des vieux papiers poussiéreux, ils feraient mieux de faire une enquête auprès des serveuses de certains très grands restaurants parisiens.
*Les lexicographes déphasés qui nous concoctent les néologismes grécos-latins destinés à obscurcir leurs discours n'ont pas encore créé de terme concernant l'écologie commençant par la lettre Y. Remercions-en les!
* On met en garde à vue 3 personnes en plein "entre deux tours" et on les relâche ! C'est quoi ce cirque, surtout quand on sait le traumatisme que peut provoquer une garde à vue (sans parler des perquisitions) ! En principe la police sait très bien pister des suspects sans avoir à les embarquer, non ? J'ignore s'il existe un délit de garde à vue injustifiée ?
**mais de quoi parle-t-on ?
* Ce con de Gibson a foutu du fil de fer barbelé sur la tête du Christ à la place d'une couronne d'épine. Or le fil de fer barbelé a été inventé par les américains en 1889.
** pitié!!
* Ceux qui parlent de révolution et de lutte de classes sans se référer explicitement à la vie quotidienne, sans comprendre ce qu'il y a de subversif dans l'amour et de positif dans le refus des contraintes, ceux-là ont dans la bouche un cadavre, non ?
µµ(Carlo Ponti - __en passant__ par la Loren)µµ
ListeDePoemes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* µ%%Querylist(Emile Verhaeren,Paul Claudel,Georges Pompidou,Habemus Ratzinger,Jean-Pierre Raffarin,Bernard et Bianca,Richard Virenque,Dick Rivers,M.A.M)%% [[La complainte de la %%Querylist(petite,grande,grosse,misérable,jolie,blonde,pulpeuse,famélique)%% %%Querylist(Paulette,sardine,petite secretaire,pétasse,soeur des pauvres,serveuse du café d'en face,secrétaire à temps partiel,grand'mère kleptomane,Carmen)%% ]µ
** ''µ- Le %%Querylist(Furet,Cri,Soleil,Devoir,Révolté,Tribun,Miroir,Canard,Clairon)%% Du %%Querylist(Nord,Pôle Sud,Limousin,Finistère,Clergé,Bazar de l'Hôtel de ville,XVIème arrondissement de Paris,Trottoir,Trou Salé)%% - %%Querynum(1848,2005)%%µ''
Inséré par [EchoBot|http://www.echolalie.com/echobot.htm]. [Actualiser ici|ListeDePoemes] pour un autre poême.
ListeDesChosesQuOnPeutOuNonTouiller
/* par PITIE ne mettez pas de liens vers de GROSSES cuillères. merci
ListeDeRoutesPourRentrerDuTravail
/*Par pitié aidez-moi à rentrer...
* En faisant un détour par la banque [http://pagesperso-orange.fr/eugene.bigotte/Images/holdup.jpg]
* En faisant un détour par le supermarché pour faire quelques courses
* En passant par Castorama
* En passant par Ikéa
* En passant par la [Lorraine|ListeLorraine] avec mes sabots, évidemment.
* En passant par la Belgique (en laissant tomber Emmanuel)
* En passant par la Lauren, comme disait Humphrey Bogart
* En passant par la pharmacie pour acheter des capotes
* En passant par la poste
* En passant par le périphérique /*http://www-compat.tf1.fr/livecam/paris.phtml?langue=fr&cam=perif1
* En repassant par ici, en repassant par là...
* Par en bas
* Par en haut
* Par l'autoroute
* Par le [périph'|http://www.perifeerique.com/fr/index.php ] à roller !!!
* Par le chemin des écoliers
* Par le métro ligne 1 si le réseau est perturbé
* Par le RER A/Chatelet/RER D (Chatelet/ST Michel/RER B si colis suspect)
* Par le train Defense-Bécons les Bruyères-Saint Lazare si le réseau est très perturbé
µµPas très intéressante cette liste... Ça doit être parce que je travaille pas... Elle va gagner le Prix de la liste la plus __lourde__ -- mais non il en y a de tellement pire, et tellement sans imagination... -- et depuis elle s'est considérablemet enrichie, améliorée et youp la boum !µµ
ListedeRevesreels
/* par PITIE ne mettez pas de liens vers de GROS rêves. merci
# Parler avec quelqu'un qu'on ne connaît pas
# Passer une nuit blanche à jouer à son jeu préféré [http://anthonychamas.free.fr/Archives/Lan_Party_28_12_2000/TN_Image-03.JPG]
# Prendre le métro [du début à la fin de la ligne|ListeDesStationsDeMetroDeLaLigneQuatre], sans aller nulle part [http://www.translocal.net/ground/dreams/kairo.gif]
# Sortir de l'autoroute par une voie de service [http://www.dinf.vd.ch/target/images/services/saf/autorouteN1.jpg]
# Sortir d'un avion par les toboggans
# Visiter une exposition de [turbines|http://mapage.noos.fr/echolalie/l139.htm][http://classes.station05.qc.ca/photos/ssparagraph/556824772f.jpg]
%%Center(''Te parler du bon temps qu'est mort ou qui r'viendra en serrant dans ma main tes p'tits doigts,'')%%
%%Center(''Te raconter la Terre en te bouffant des yeux, Te parler de ta mère un p'tit peu,'')%%
%%Center(''Et entendre ton rire comme on entend la mer s'arrêter, repartir en arrière,'')%%
%%Center(''Te parler du bon temps qu'est mort et je m'en fous, Te dire que les méchants c'est pas nous,'')%%
ListeDeReves
/*Par pitié pas de gros rêves...
* Ce matin je me réveille, à côté de moi dors Monica Bellucci, j'avale mon café sur la grande terrasse de ma maison du Lubéron, je passe un coup de fil à quelques potes, je rentre dans mon garage de 300m Carré et je choisit parmi ma collection d'auto et de moto, la moto que je vais prendre pour aller tirer la bourre avec mes potes.
* Il ne reste plus qu'une chambre à l'hôtel, je la prends, Sharon Stone est derrière moi et se lamente qu'elle va passer la nuit dehors, je lui offre alors de partager mon lit, et comme ça m'excite de trop je me réveille...
**Nous pouvons imaginer deux sortes d’Univers. La première correspondant à notre Univers, et constituée de tardyons, particules qui vont moins vite que la lumière, et peuvent accélérer jusqu’à s’en approcher, tandis que leur énergie augmente.
**L’autre catégorie d’Univers est composée de tachyons, particules plus rapides que la lumière, qui peuvent ralentir jusqu’à sa vitesse tandis que leur énergie augmente.
**Entre les deux se trouve le mur des luxons, où se trouvent les particules qui vont exactement aussi vite que la vitesse de la lumière. Ce mur est mitoyen entre les deux Univers.
**Si un tachyon possède assez d’énergie, et par conséquent, se déplace assez lentement, il peut rester à la même place assez longtemps pour engendrer une explosion de photons détectables,( les tachyons laisseraient une traînée de photons même dans le vide ). Les physiciens guettent une telle explosion, mais il y a peu de chances d’avoir un instrument à l’endroit exact où l’une de ces explosions ( probablement très rare ) pourraient se produire, pendant un milliardième de seconde ou moins.
* Je rêve d'être le soutien gorge d'une Lætitia Casta qui ne parlerait pas.
* Je rêve de partir à Mykonos avec Roger -µ%%Blue( Merci de ne pas en causer à Raymond...)%%µ
* après le boulot, prendre ma Ferrari vers 14h30 pour aller picoler au Tilsit...puis aller me faire sucrer mon café du pauvre par Carmen, sa fille, Clara ou une autre ( mais pas la même qu'hier )...
* Partir avec 100 000 Euros avant la fermeture à 0 Euros.
/* non, parce que ce ne sont que des extraits
Respirer la violette à Parme Et les épices à Colombo
J't'apprendrai, à la Jamaïque La pêche de nuit au lamparo
On s'ra fasciné au Prado Par les Goya ou les Menine.
** Il les 4 as, les 4 rois, les 4 dames, les 4 valets et un dix, il demande le chelem à tout atout et l'adversaire entame d'une cinquième couleur verte qu'il ne connaissait pas... - Tout atout ? On n'est pas a la belote ! -µ%%Red( Félicitations ! C'était l'une des ''sentinelles'' destinées à mesurer la vigilance des participants; il est réconfortant de noter qu'il y en a qui suivent, fût-ce et y compris en fin de page...)%%µ} J'ajouterai d'ailleurs - pour démontrer que notre vigilance est totale -, y compris après les notes et codicilles de bas de commentaires, qu'il est rare de voir des mains de 17 cartes au bridge, sous nos latitudes... -- De toute façon, il est encore possible que le voisin de gauche ou de droite ait 8 atouts.
ListeDeFilmsPourAvoirPeur
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Le __Crime était presque parfait__ (1954) de Alfred Hitchcock
* __Jurassic Park__ (1993) de Steven Spielberg
ListeDePositions
/*Par pitié ne mettez pas de liens vers des grosses images de positions. merci
%%Center(''µAinsi parlait Kamasoutraµ'')%%
* Je n'en ai discuté avec personne, mais c'est la position de mon parti. '' Georges Marchais''
# 69 µµ(Lyon qui se trouve dans le 69 est également la capitale des [Gaules|ListeDeBite] et de la [rosette|ListeDeMotsRelatifsAlaPartiePosterieuredesHumains])µµ
# 96 µµl'impossible 69 à l'envers -- dos contre dos par contre on peut faire autre chose dans cette position, voir illustration du __baiser à la capucine__ dans cette [autre liste|ListeDeBaisers]µµ
# 99 désigne parfois la ''position des cuillères''
# Bateau ivre : la femme est semi allongée sur le lit sur le dos, mais sans les jambes (qui restent à l'extérieur du lit). L'homme est debout, s'approche, écarte les jambes de sa partenaire et la pénètre ainsi.
# Brouette de Zanzibar : La femme s’appuie sur ses mains. L'homme lui prend les pieds et la pistonne par-derrière, tout en avançant.
# %%Green(de départ)%%
# De [l'antilope|http://www.grapheine.com/bombaytv/play_fr.php?id=1100000] : À genoux, l'homme pénètre la femme par derrière. Autrement dit, c'est une levrette.
# De l'[avion|ListeDeCompagniesAeriennesImaginaires] : Celle ou celui qui fait l'avion est debout penché en avant, les bras écartés, et cinq partenaires se positionnent autour.
# De l'huître : Allongée sur le dos, la femme replie ses cuisses contre son ventre. L'homme la tient par les genoux. [http://idata.over-blog.com/0/08/51/86/huitre_creuse.gif]
# De la fleur éclatée : ''Etendue sur le dos, la femme replie les jambes sur son ventre jusqu’à ce que ses genoux s’approchent des seins. L’homme s’agenouille au-dessus d’elle et la pénètre doucement. Les pieds de la femme sont placés de part et d’autre des reins de son partenaire.''
# %%Red(du loir)%% (pas donné... parce que la position du loir et cher) :-)
# Du rodéo : Tu te mets sur ta femme, tu la caresses et puis tu lui dis à l'oreille : "''ton parfum est le même que celui de ma secrétaire !''" Ensuite, tu essayes de rester plus de 5 secondes dessus...
# Du tourniquet esbaudi cité par Jules Antonin [Fabrasme|ListeDuFabrasme] (1423-1502)
# Grande roue mexicaine : Position évoquée par Mary Steenburgen dans le film "Comédie érotique d'une nuit d'été" (Woody Allen 1982)
# La Bête à deux dos : pendant lequel les deux fouteurs, scellés ensemble par le ventre, ont l’air de n’avoir que des dos. L’homme et la femme couchés en vis à vis l’un de l’autre, ce qu’on appelle encore danser à plat, baiser à la papa, ourser (les gens grossiers), la position naturelle (M. Prudhomrae, les épiciers et tous les maris honnêtes). µµdictionnaire de l’érotisme moderne de A Delvau 1850µµ
# Le mobile du Moulin : la femme tourne pivote autour de son partenaire en utilisant sa verge comme un axe
# [Levrette paresseuse ou simplement "Paresseuse"|ListeParesseuse] :quand les deux amants sont couchés sur le côté, l’homme derrière la femme. Dans cette position, la femme remuant peu, peut fatiguer successivement un grand nombre d’hommes. µµdictionnaire de l’érotisme moderne de A Delvau 1850µµ
# Poirier anal : Monsieur est debout, Madame fait le poirier contre lui. ''(popularisé au cinéma par l'actrice américaine Gauge)''
# Sexuelle : Une position sexuelle est la manière dont deux ou plusieurs partenaires positionnent leur corps lors d'un rapport sexuel -- µµtrop fort !µµ
# Dans un parking
# Sur le parquet
* En Angleterre ça s'fait par terre
* La Bretagne se distingue du reste de la France par sa position au bord de la mer.
# [Marteau|ListeDeMarteau] pilon guyanais (non identifié mais cité par Brice de Nice)
# Police Secours : - Vous avez appelé la police ! Ne quittez pas ! Tous nos opérateurs sont actuellement occupés, commencez par nous signalez votre __position__, s'il s'agit d'un viol, ne bougez pas... [http://francois.chastanet.free.fr/images/flic.jpg]
ListeDesVraiesRaisonsAlaCrise
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* C'est la faute aux socialistes.%%%µµ(lu pour de vrai sur un forum avec de longues explications. Des gens de [par-là|http://www.wikiberal.org/wiki/Accueil].)µµ
/* %%Image (http://ouistreham.parti-socialiste.fr/files/international-socialiste.jpg,100,101)%% */
/* [http://www.come4news.com/images/stories/parti-socialiste.gif]
µµ-- Comment savez-vous que c'est le dernier étage?µµ%%%µµ-- Ah, c'est vrai que la ListeDesEvenementsLesPlusImportantsDeLaBiographieDeGeorgesBrougnard ne parle pas de son emménagement dans son loft.µµ%%%µµDommage, c'était une fête plutôt swing, les zazous.µµ
* Tout a été orchestré par le Professeur Mangemanche. Il nous a déclaré :%%%''"C'est exprès. C'est pour me venger. C'est depuis que Chloé est morte."''
ListeDesMotsFemininsQuiSeMasculinisentAvecUnEfinal
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Testostérone ? µµ- Oui, notamment, mais bon... (Ah ouiii, cela se termine par un -e et ça masculinise... chôli!)µµ
[Jchrbe|ListeDesListesImpulseesParJchrbe]
ListeDeQuandJeSeraiGrand
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
*Quand je serai grand, je serai moins petit, je montrerai mon q partout dans Passy, ma mère me dira 'veux-tu le cacher!', je lui répondrai 'veux-tu l'embrasser?'
*Quand je serai grand, je serai plus grand que les mecs qui crachent par-terre et je leur crierai dessus:" EJACULATEUR PRECOCE!!!" avec une grosse voix virile, et ils se mettront à quatre pattes pour nettoyer leurs glaires.
ListeDeToutMaffligeEtMeNuitEtConspireAmeNuire
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListeInventaireDuMinimumNecessairePourPartirEnExploration
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
!%%Center(__Liste inventaire du minimum nécessaire pour partir en exploration__%%%en Molvanie ou autre contrée)%%
ListeDeDebuts
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Anton Voyl n'arrivait pas à dormir. Il alluma. Son Jaz marquait minuit vingt. (Georges Perec, La ''Disparition'')
/*De la Vache... (''Coran'') µµ- N'est-ce pas la seconde, et non la première ?? -- la première, c'est pas plutôt: ''Putain, la vache!''? (oui, bon) ...et la vache rousse, au fait, en parlant de vache, c'est dans laquelle ? ... je me suis mis un peu au Coran, et en fait, ça commence par : ''Au nom d'Allâh Le Très Miséricordieux, Le Compatissant Louange à Allâh...'' (pas de quoi tuer une vache) -- Eh bien voilà, c'est bien celle-là, la première sourate... La vache, c'est la seconde...µµ
* C’est sur les instances de M. le chevalier Trelawney, du docteur Livesey et de tous ces messieurs en général, que je me suis décidé à mettre par écrit tout ce que je sais concernant... (R.L. Stevenson, ''L'île au trésor'')
* Comment s'étaient-il rencontrés? Par hasard, comme tout le monde (__Denis Diderot__, ''Jacques le Fata-liste et son maître'' 1778-80)
* – Еh bien, mon prince. Gênes et Lucques ne sont plus que des apanages, des поместья, de la famille Buonaparte. µµ(ceci aussi c'est de la littérature russe dans le texte!)µµ (Léon Tolstoï, ''Guerre et Paix'') µµ effectivement !!µµ
* Enfants, jeune lignée de notre vieux Cadmos, que faites-vous là ainsi à genoux, pieusement parés de rameaux suppliants? La ville est pleine tout ensemble et de vapeurs d'encens et de péans mêlés de plaintes. (Sophocle, ''Oedipe Roi'')
* Gallia est omnis divisa in partes tres, quarum unam incolunt Belgae... (C.J. Caesar, La ''Guerre des Gaules'')
** µLa Gaule est divisée en trois parties, dont une est habitée par les Belges...µ
* Im achtzehnten Jahrhundert lebte in Frankreich ein Mann, der zu den genialsten und abscheulichsten Gestalten dieser an genialen und abscheulichen Gestalten nicht armen Epoche gehörte. (Patrick Süskind, Das ''Parfum - Die Geschichte eines Mörders'')
** µAu XVIIIµµ££ème££µµ siècle vécut en France un homme qui compta parmi les personnages les plus géniaux et les plus abominables de cette époque, qui pourtant ne manqua pas de génies abominables...µ
* La guerre menée par les Juifs contre les Romains est la plus considérable non seulement de celles de notre temps mais peut-être aussi de celle dont le récit nous est parvenu... (Flavius Josèphe, La ''Guerre des Juifs'', trad. P. Savinel)
* L'année 1866 fut marquée par un événement bizarre, un phénomène inexpliqué et inexplicable... (Jules Verne, ''Vingt mille lieues sous les mers'')
* Le reflet de la porte vitrée du parloir passa brusquement sur le sable de la cour, à nos pieds. (Valery Larbaud, ''Fermina Marquez'')
* La lune était en son plein, le ciel était découvert, et neuf heures du soir étaient sonnées lorsque nous revenions d'une maison proche de Paris, quatre de mes amis et moi. (Cyrano De Bergerac, "Les états et empires de La lune")
* Louvre Museum, Paris 10:46 P.M. Renowned curator Jacques Saunière staggered through the vaulted archway of the museum's Grand Gallery. (Dan Brown, ''Da Vinci Code'') /*µJamais réussi à lire beaucoup plus loin que cette première phraseµ
* Mme Dumont-Dufour et Mme Blok parlent de leurs malheurs... (René Crevel, La ''Mort difficile'')
* Nominato ufficiale, Giovanni Drogo partì una mattina di settembre dalla città per raggiungere la Fortezza Bastiani, sua prima destinazione. (Dino Buzzati, Le ''Désert des Tartares'')
** µC’était à Moscou au déclin d’une journée printanière particulièrement chaude. Deux citoyens firent leur apparition sur la promenade de l’étang du Patriarche. Le premier, vêtu d’un léger costume d’été gris clair, était de petite taille, replet, chauve, et le visage soigneusement rasé s’ornait d’une paire de lunettes de dimensions prodigieuses, à monture d’écaille noire...µ
* Raymonde prêta l’oreille. De nouveau et par deux fois le bruit se fit entendre... (Maurice Leblanc, L'''Aiguille creuse'')
** µLa ville de Rome fut d'abord aux mains de rois; la liberté et le consulat furent établis par L. Brutus.µ
**µTous les bonheurs se ressemblent, mais chaque infortune a sa physionomie particulière...µ
* Au milieu de l'été dernier, une petite ville de la côte norvégienne fut le théâtre d'événements tout à fait insolites. Un étranger arriva, un certain Nagel, charlatan étrange et singulier, qui fit nombre d'extravagances, avant de repartir aussi subitement qu'il était venu. µµ(moyennement facile: il s'agit d'une traduction)µµ
* Ce soir-là, qui était celui où MM. Debienne et Poligny, les directeurs démissionnaires de l'Opéra, donnaient leur dernière soirée de gala, à l'occasion de leur départ, la loge de la Sorelli, un des premiers sujets de la danse, était subitement envahie par une demi-douzaine de ces demoiselles du corps de ballet qui remontaient de scène après avoir "dansé" ''Polyeucte''.
* Comme je l'ai déjà dit ce sont les prêtres du Tutuguri qui m'ont ouvert la route du Ciguri comme quelques jours auparavant le ''Maître de toutes les choses'' m'avait ouvert la route du Tutuguri. µ(Antonin Artaud, µsi!µ, mais quel texte précisément?)µ
* Comment s'étaient-ils rencontrés? Par hasard, comme tout le monde µµ(un des meilleurs débuts de la littérature, enfin, je trouve...)µµ
* - Cuatro - dijo el Jaguar. Los rostros se suavizaron en el resplandor vacilante que el globo de luz difundía por el recinto, a través de escasas partículas limpias de vidrio...
* If you really want to hear about it, the first thing you'll probably want to know is where I was born, and what my lousy childhood was like, and how my parents were occupied and all before they had me, and all that David Copperfield kind of crap, ...
* Il tenait de la main droite une espèce de long bâton noirci du bout qu'il enfonçait par moment dans le feu; l'autre main reposait sur sa cuisse gauche.
* La magnificence et la galanterie n'ont jamais paru en France avec tant d'éclat que dans les dernières années du règne de Henri second.
* Les papiers publics se sont beaucoup occupés d'une affaire mystérieuse: celle de ce jeune fossoyeur condamné à six mois de prison pour violation de sépulture et emporté depuis par une fièvre cérébrale. µµ(très difficile)µµ
* Non jamais le navire Argo n'aurait dû parvenir en Colchide forçant au vol la passe couleur de nuit des Symplégades!
* Parole de bénédiction d'Hénoch. C'est ainsi qu'il bénit les ''élus'' (et les) justes qui (verront) au jour d'angoisse l'extermination de tous les ennemis et le salut des justes. µµ(assez difficile, quoique)µµ
* "Pourquoi me soutenir que tu sais ta leçon? Tu vois bien que tu ne la sais pas!... Tu l'as apprise par coeur? vraiment?"
* Trois heures du matin. Je perçois cette seconde, et puis cette autre, je fais le bilan de chaque minute. Pourquoi tout cela? - ''Parce que je suis né.''
* Vers la fin du mois d'octobre dernier, quelques temps après l'heure à laquelle s'ouvrent les maisons de jeu, conformément à la loi qui protège, à Paris, une passion essentiellement budgétifiante, un jeune homme vint au Palais-Royal; et, sans trop hésiter, monta l'escalier du tripot établi au numéro 39.
* - Veux-tu lire ce qu'il y a d'écrit au-dessus de ta partition? demanda la dame.
* Weidmann vous apparut dans une édition de cinq heures, la tête emmaillotée de bandelettes blanches, religieuse et encore aviateur blessé, tombé dans les seigles, un jour de septembre pareil à celui où fut connu le nom de... (Jean Genet, "Notre-Dame-des-Fleurs")
Prière de ranger les débuts dans la première partie de liste une fois que vous avez trouvé...
ListeDePerversions
/* par PITIE ne mettez pas de liens vers de GROSSES perversions. merci
%%Center(%%Green(µLes noms de perversions n'appartenant pas strictement au domaine sexuel sont en vert,µ)%%''µ les noms de perversions condamnables (et il y en pas tant que ça) sont en italique.''µ)%%
* Ne pas parler de sexualité c'est... ne pas parler de soi. ''Michel Conte''
* Agoraphilie : Mot employé (pour la première fois ?) par Erik Orsenna dans son livre "L'exposition coloniale" (prix Goncourt 1988) qui signifie le contraire de l'agarophobie, donc : l'amour des places publiques, la passion des foules. Depuis le terme a subi un glissement sémantique connoté sexuellement et signifie la recherche de possibilités de pratiquer l'acte sexuel dans des lieux publics ou semi publics (et dans lesquels on risque de se faire surprendre.)
* Bandonéon : Individu sexuellement excité par la lumière artificielle
** regarder une émission tv présentée par Frederic Beigbeder
* Bettyboopisme : attirance provoquée par les brunes coquines aux cheveux courts et en petite robe noire ?
* B%%Red(OO)%%nnesactricophilie : variation de la mamophilie, polarisation des sujets sur certaines actrices en particulier : Ornella Muti, Mathilda May, Betty Page, Ava Gardner, ainsi que pour les héroïnes des films de Russ Meyer
* Bouboupisme : excitation provoquée par le pincement des tétons par un partenaire ou par soi-même.
* Branlette (''µDans la réalité, on se branle souvent tout seul, c'est dans les livres qu'on se fait branler par sa bonne.'' Esparbec µ)
* Candaulisme : excitation de voir son (sa) partenaire avoir des relations sexuelles avec une autre personne.
**µµon trouve parfois par erreur l'expression caudalisme à la place de candaulisme, amusant parce que fabriqué avec la racine "caudal" qui signifie "se rapportant à la queue".µµ
* %%Green(Capillorophocaphilie)%% : poser des bigoudis à un phoque [http://educ.csmv.qc.ca/MgrParent/vieanimale/mam/Phoque06/phoque.jpg]
* %%Green(Carillodringomanie)%% : action d'activer de façon compulsive les sonnettes d'entrée se trouvant sur le parcours
* %%Green(Cataphilie)%% : Action de se balader (de préférence de façon clandestine) dans les structures souterraines créées par l'homme dans les sous-sols des grandes villes (carrières, catacombes, égouts...)
* Chinchardophile : Cas particulier de zoophile, mais en pirse (pirse c'est le superlatif de pire, qui est déjà un superlatif, c'est dirse!) - personnage extrêmement trouble, exclusivement obsédé par cet animal aquatique méconnu qu'est le chinchard, au point qu'il en veut faire mention partout ! Restez sur vos gardes car sûrement un chinchardophile n'est pas loin de chez vous et guette ! Surveillez vos listes aussi, car c'est là que ses attaques se font de la façon la plus sournoise ! Mwi !... Chinchardophilophobe de tous horizons, levez-vous ! L'heure est grave !
* Chrematitosphilie : Fait de payer pour avoir des relations sexuelles, et d’en tirer du plaisir. (la relation n'est pas obligatoirement prostitutionnelle, le chrematitosphile peut par exemple demander à son épouse de s'habiller "en pute" et la rétribuer.
* Cinépimastie (ou Coït intermamaire ou Mamagymnophilie ou encore Mazophallation) : masturbation entre les seins (on parle aussi de "branlette espagnole", de "cravate de notaire" ou d'Entrenichon) - µ''certains écrivent ce mot avec un ou deux y, il n'y a aucune raison... et de nombreux dictionnaires du sexe l'orthographient a tort cinépysmathie)''µ
* Claustrophilie : Situation de replis extrême au niveau de son territoire. Pratique à tendance masochiste consistant à trouver du plaisir dans une situation d'enfermement (placard, cage, cave, grenier...) On site l'exemple de l'acteur américain Bela Lugosi qui s'enfermait parfois... dans un cercueil.
* Communisme en chambre : l'expression est un peu démodée mais pas la pratique ! Il s'agit du partage volontaire du conjoint (ou de la conjointe). Ce n'est pas synonyme de triolisme puisque tout ça peut se faire à deux.
* Culomane : néologisme qui se comprend tout seul. Quand on sait qu'il a été inventé par Roger Peyrefitte, on comprend encore mieux :-) Ce dernier a aussi inventé un autre mot pour exactement le même chose, Pygolâtre, mais c'est moins joli
* Ectomorphophilie : Excitation provoquée par les personnes très maigres
*%%Green(Embolalie)%% Introduction involontaire et répétée de mots ou interjections sans valeur sémantique précise dans le langage parlé ("euh", "ben", "n'est-ce pas", "tu vois" etc.).
* ''Erotophonophilie : variante aggravée de l'hybristophile. Les érotophonophiles recherchent comme partenaires sexuels des meurtriers sexuels.''
* Farting : jeu sexuel incluant des flatulences. Il n'existe pas de synonyme français (au moyen âge on parlait de "pète-en-gueule" mais ce terme a plutôt le sens d'anulingus au sens large)
* Fat admirer (ou F.A) : Attirance prioritaire vers des personnes obèses (on parle aussi d'obèsophilie)
* Flagellation [http://www.retrouversonnord.be/fichiers_parcours/fessee.jpg]
* %%Green(Floodisme (ou Flood))%% : µNévrose courante sur les forums de discussions, le floodeur se livre à une overdose de visibilité en intervenant partout à la fois, accumulant les contributions le plus souvent inutiles et creuses. Il faut dire aussi que les responsables de forums encouragent inconsciemment ce genre d'attitude allant même jusqu'à donner des grades aux intervenants les plus fécondsµ
* Godivisme : Pulsion conduisant à s'exhiber à cheval. Par extension, amateur/voyeur de cavalières nues (le mot est construit en référence à la légende de [Lady Godiva|ListeDeFemmesIntrigantes]). L'exhibition à bicyclette ou à moto peut être considérée comme une forme de godivisme.[http://lenaweb.voila.net/LadyGodiva/Godiva_figurine2.jpg]
* Gymnophoria : C'est la sensation de se sentir déshabiller mentalement par autrui. ''µC'est fini, j'prend plus le métro, c'est trop la gymnophoria !µ''
* Gynotikolobomassophilie : Passion pour le "gnougnoutage" du lobe de l'oreille de sa (son) partenaire. Dans le film les Intouchables (Nakache et Toledano, 2011), François Cluzet se fait titiller les lobes des oreilles par une masseuse asiatique
* Karezza : Discipline prônant la continence sexuelle contrôlée (par exemple "dans les moments de plaisir érotique maximal, des pauses totales de relaxation avec le pénis en érection dans le vagin - ''jusque-là c'est assez clair c'est après que ça se complique'' – temps durant lequel les amoureux savourent le transfert réciproque des fluides énergétiques sexuels...") Ne pas confondre avec Carezza qui signifie caresse en italien !
* Knismolagnie : excitation sexuelle par des chatouilles.
* %%Green(Logorrhée)%% Littéralement diarrhée verbale ou incontinence verbale. Trouble du langage caractérisé par un besoin irrésistible et morbide de parler. Syn = Verbigération.
* Mélomanie : classé comme "perversion" par Woody Allen qui en donne la définition suivante : "''Un mélomane est quelqu'un qui, entendant chanter Ornella Muti dans sa salle de bains, colle son oreille au trou de la serrure''"
* Nasophilie : attirance sexuelle pour les nez longs et pointus (le syndrome de Cléopâtre) et par extension pour les nez en général.
* Nasomycinophilie : Excitation sexuelle provoquée par les sécrétions nasales.
* Oragénitalisme : Action d'étaler la nourriture préférée d'un animal sur les parties sexuelles d'une personne devant être soumise à l’animal.
* %%Green(''Orgasme du lâche'')%% : Plaisir de faire du mal en tout impunité, cette névrose devient aujourd'hui plus "visible" à cause des progrès de la télécommunication privée (téléphone, minitel, internet...). Il se traduit par des dénigrements, insultes, provocations, duplicités, menaces, invectives, mise en scènes, destructions.... ''Remède : un suppo et au lit !''
* P.S.G : µ''Quand Monsieur D... les prévenait "demain sera PSG" Clémentine et Arizona savaient bien qu'il ne s'agissait pas d'aller s'exhiber au Parc des Princes mais de participer à une "Petite Soirée Grivoise"''µ
* %%Green(Paraflotophilie)%% : Passion immodéré pour les parapluies, le paraflotophile les collectionne et sort toujours muni d'un parapluie très visible même par beau temps.
* Parthénophilie : Plaisir de déflorer
* Partouse : ''lu dans les perles du bac :'' "L'indice de fécondité doit être égal à 2 pour assurer le renouvellement des générations parce qu'il faut être 2 pour faire un enfant. On peut s'y mettre à 3 ou 4 mais 2 suffisent."
* Podiaphilie : Fétichisme des tabliers de femme (et par extension des tenues de soubrettes) Très souvent couplé avec une passion immodérée pour les amours ancillaires.[http://jeanpierre.bizon.free.fr/serveuse.jpg]
* [P|http://www.echolalie.com/l1156.htm]__%%Red(o)%%__[dophilie|http://www.echolalie.com/l1156.htm] : non donné parfois au fétichisme du pied.
* Pogonophilie : attirance féminine exclusive envers des partenaires barbus - attirance masculine envers des partenaires féminines à pilosité hors norme - s'emploi aussi pour les collections sur le thème des femmes à barbe [http://www.cartes-france.com/cartesgrd/fbarbe.jpg]
* %%Green(Remontophilie)%% : µPerversion courante constatée dans les forums et autres sites Internet interactif (les wikis ne sont donc pas épargnés) consistant à "remonter" un élément afin de lui redonner de la visibilité. Cala se fait souvent aucun ajouts ni commentaire, si ce n'est que parfois le mot "up" (forums)µ
* Salade : à l'origine, "partouze de légumes qui aiment à être mélangés." ''Venez chez nous samedi soir avec votre épouse, on fera une petite salade''
* Sautopafie : Néologisme fabriqué à partir de la BD de Cabu "Catherine saute au paf"
* Sex-Rodéo : L'homme se met sur la femme, la caresse, puis lui susurre à l'oreille : "''C'est marrant, tu te mets le même parfum que ma secrétaire !''". Il faut après cette confidence qu'il parvienne à maintenir la position pendant plus de 10 secondes !
**''µ"Si on a un petit cul de danseuse comme le mien, la douleur et la jouissance de la pression interne de la sodomie sont inséparables." - Toni Bentley, ex ballerine new-yorkaise in "Ma reddition" (ed Maren Sell).µ''
* %%Green(Stichomythie)%% : Non il ne s'agit pas de l'art du mensonge chez les asticots, mais d'une figure de style théâtrale ou les protagonistes se répondent vers contre vers. Par glissement sémantique, désigne une aptitude systématique à faire des réponses concises en employant des mots recherchés voire précieux.
* Syndrome de la psyché : Excitation sexuelle provoquée par son propre reflet dans un miroir.
* %%Green(Toiturophilie)%% : Action des se balader notamment sur les toits d'immeubles, les parties hautes d'églises, les cheminées ou les grues.
* Trichophilie : excitation sexuelle provoquée par les poils.
* Trimammophilie : (ou Trinichonophilie) autrement dit le fantasme de la femme à trois seins. On retrouve la trace de ce fantasme très ancien dans certaines légendes celtes, notamment celle de Sainte Gwenn (Blanche) en Bretagne qui enfanta de trois triplés, destinés à devenir trois saints, pour ce faire Dieu la dota d'une 3ème mamelle (ça ne s'invente pas). De l'Inde nous vient aussi la légende de la très agressive Meenakshi qui possédait des yeux de poisson et trois seins, (mais le 3ème disparut quand Shiva l'épousa). Paul Verhoeven en 1990 avec Totall Recall a ressuscité le mythe en de très brèves mais marquantes images (magnifique Lycia Naff). [Pour en savoir plus...|http://sachatchenko.voila.net/Mutantes.htm]
* %%Green(Tuvoisie)%% : La [tuvoisie|ListeDeProblemesEtMaladiesEnRapportAvecLeLangage] est une perversion se manifestant par un appel au voyeurisme envers son interlocuteur : "''Tu vois, moi on me l'a fait pas, alors je lui ai répondu du tac au tac... Tu vois ?''"
* Verdure (faire la) : Se prostituer dans un parc.
**"''Obscena observandi cupido''" traduction latine de "voyeurisme" par les comiques du Vatican.
**''Se mettre du miel entre les jambes pour se faire lécher par un petit chien, c'est permis à la rigueur, mais il est inutile de le lui rendre..." -- [Pierre Louÿs|ListePourPierreLouys]''
**µ''La zoophilie est-elle une perversion poussant à aller au zoo plusieurs fois par jour ?''µ [http://lassilia.voila.net/Image_dico/bouc.jpg]
* Le premier ouvrage "moderne" à s'intéresser aux "perversions" fut publié en latin par Friedrich-Karl Forberg (1770-1848) sous le titre "De Figuris Veneris". Il fut traduit en français en 1882 par Alcide Bonneau (collaborateur de Pierre Larousse) sous le titre "Manuel d'érotologie classique" tous les termes jugés grivois étant remplacés soit par des mots en vieux français, soit par des néologismes : ainsi l'ouvrage classe les "perversions" en différents chapitres aux noms parfois surprenants :
* Bare-backing : littéralement monter à cru ... refus du préservatif avec des partenaires de rencontre
* Calicaliphilie : excitation sexuelle provoquée par les habitants de Cali-Cali
* Coït : ne convient pas puisque pour ceux qui trouvent des perversions partout le coït n'en est pas une.
* Guatémaltècopholie : excitation sexuelle provoquée par la vision de son partenaire chantant guatémaltèque sous ses fenêtres.
* Hétérosexualité : ne convient pas puisque pour ceux qui trouvent des perversions partout l'hétérosexualité est la norme.
* %%Green(Métaphore canine du marabout)%% : ''Combien de fois avons pu lire sur un petit papier qu'on nous distribuait cette phrase étrange "Si ta femme (ou ton mari) est parti, elle (il) reviendra derrière toi comme un toutou derrière son maître" ? Une telle poésie méritait bien la postérité...''-- µµpeut-être, mais sa place dans cette liste parait un peu tirée par les cheveux...µµ
* Neronctomanie : attirance sexuelle pour les Neronctologues (savants obsédés par la vie de Néron).
* Onanisme transcendantal (par homéo-astrologie vectorielle) (?)
* Poulaupotophilie : excitation sexuelle provoquée par le bouillon de poule.
* Purdeyshzysophilie : excitation sexuelle provoquée par les gens qui mangent la bouche ouverte.
* µµ%%Green(Ici, c'est une liste sérieuse ! On ne parle que de sexe !)%%µµ -
µµIdée originale de Siegmund. Liste complémentaire par El Jj -- Modifiée par Msblast (virus) -- Fusionnée et classée par Sylvain -- Sponsorisée par ? -- Débugué par Edµµ
ListeDePersonnages
/*Par pitié ne mettez pas de liens vers des images de grossiers personnages, merci bien beaucoup !
* Un guide birman (on se demande ce qu'il fout là - mais ils sont fourrés partout)
ListeDePhrasesCultesDansDesSketchesComiques
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
** ''... Et maintenant, nous entrons dans la chapelle : Rasée par le Prince Noir, incendiée par les Huguenots, pillée par les Sans-culotte aux révolutions de 89, 30 et 48, la chapelle est entièrement d’époque...”'' ! (Jacques Dufilho - ORTF - 26/10/1957)[http://pagesperso-orange.fr/lemomo2/Dufilho_Victorine.jpg]
** Francis Blanche - Ah bon, mais qu'est-ce que vous entendez par là ?
** Dac - Oh ! par là j'entends pas grand-chose...
** Je suis pas du genre à me laisser emmerder par un tas de ferraille…
* La guerre de sécession par Roger Pierre et Jean-Marc Thibaut
* [Le Schmilblick|http://pagesperso-orange.fr/lemomo2/Schmilblick.htm] par Coluche
* La drague par Guy Bedos et Sophie Daumier
* [Télémagouille|http://lemomo2.pagesperso-orange.fr/Telemagouille.htm] par les inconnus
** Il était capable de casser un oeuf... rien qu'en le lâchant par terre !
** Je dois me rendre à Pau le plus vite possible parce que je vais à l'enterrement d'un vieux camarade, alors je voudrais lui serrer la main une dernière fois avant qu'il ne meure.
* Valérie Lemercier + Kad & Olivier, [La Partouze|http://www.dailymotion.com/relevance/search/lemercier+kad/video/xr1nb_lemercier-et-kad-o-partouze_fun]
µµlancée par ?µµ
ListedeModes
/*Par pitié pas de grosses modes
* Janvier 1965 : commercialisation des premiers collants (invention française de l'industrie du chaussant) - lancement de la mini-jupe par le couturier Courrèges
**''et oui ça existe, dans les années 1970 vous ne pouviez pas vous faire inviter chez quelqu'un sans échapper au soufflé au fromage (qui en cuisine aujourd'hui ?). A cette époque on offrait en cadeau des yaourtières et des sorbetières (aujourd'hui en brocante ça ne part même pas pour 4 euros)''
**''et de ceux qui veulent nous faire croire que c'était une époque formidable, où tout le monde vaquait au milieu de beaux troubadours, de montreur d'éperviers, de jongleurs et de gentes demoiselles... en oubliant les épidémies, l'obscurantisme, les famines, le servage, les guerres incessantes, la misère partout... sauf pour une poignée de seigneurs et de curés... boycoter les festivals médiévaux me parait une action très saine !''
*Mode indicatif, subjonctif, impératif - euh yen a d'autres ? - µoui, par exemple le %%Blue(''conditionnel'')%%, le participe, ou le [surconditionnel|http://www.langue-fr.net/ougrapo/surconditionnel.htm]µ
**''(le journal auquel est abonné Bernard Thibault (parce que dedans il y a toujours un patron à découper)''
*mode subjectif plus qu'imparfait : Que tu %%Queryword(verb,*asses)%%
µCommuniqué par Ads & PHE --Modifié par : [EchoBlast (virus)|http://www.echolalie.com/echobot.htm],...µ
ListedeMetiersOuOnEstPayeArienFoutre
/* par PITIE ne mettez pas de liens vers de GROSSES feignasses. merci
* Back up humain de l'horloge parlante
** Katia : - Pardon ?
* Evéque sans [diocèse|http://www.partenia.org/] --- Mgr Gaillot n'est pas à proprement parler le modèle même de personne payée à ne rien faire ! mais c'était pour faire un bon mot...
* Etrangleur de chat par la queue
* Gardien de phare ([est rond|http://www.paroles.net/texte/15319])
* Gardien de parc
* Gargouille à Notre-Dame de Paris ! [http://www.ac-versailles.fr/etabliss/clg-camus-bois-colombes/siteMoyenage/Roman59-03/page10/gargouille.jpg]
* Mère Noëlle (et tout particulièrement Mère Noëlle en Arabie Saoudite
* réparateur de moniteurs pour les sportifs
[http://www.francparler.org/fiches/img/cartoonerie2.gif]
* Réparateur de confessionnal
* Remplaçant (en particulier quand il n'y a personne à remplacer)
* [Réparateur de PC|http://www.cpu.lu/~gkes/pcrepair/]
* [Réparateur de PC (niveau II)|http://members.aol.com/spoons1000/break/index.html]
* Chef de réparateur de PC
* Zouave au pont de l'Alma [http://b2cool.tripod.com/paris2001/zouave.jpg]
* Gigolo (parce que dire qu'un Gigolo est payé a rien foutre est une contre-vérité mannfeste)
ListeDeMedicaments
/*Par pitié pensez au trou de la sécu...
* Gélabitmol : Boîte de 28 gélules de 200 mg, des laboratoires BRAGGET & MOLL, ce médicament se pose en conçurent direct du Viagr&#97 car son principe actif, la gourdinbilline, apparaît cinq fois plus efficace. Notons que l'excipient à base de mandragore, de bave de crapaud et de poudre de corne de rhinocéros finira de convaincre les plus sceptiques.[http://conspiration.ca/humour/medoc5.jpg]
* Propofan (2 cps 3 fois par jour)
ListedeLivresFavoris
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
__Commençons par La liste dressée par Georges Perec lui-même ([Cantatrix|http://www.pianotype.net/doc/tomatotopic.htm] Sopranica)__
*Mason, H.W. & Rangoun, S.W. Paratrigeminaloid musicalgia. In: 3rd Conference on the Rimsky-Korsakoff syndrome, ed. by T. Thanos & P. Roxidase, Springfield, Ill., C. C. Thomate, pp. 31-57, 1960.
*Otis, J. & Pifre, K. Gasping in the ascending pathways. In: Hommage à Henri Eiffel, ed. by D. Haux & D. Bas, Paris. C.N.R.S., pp. 347-950, 1964.
*Pompeiano, O., Vesuviana, A., Strombolino, H. & Lipari, G. Volcaniche effetti della formazione reticolare nella funiculi funicula. C.r. Ass. ital. Amat. Bel Cant. 37, 5-32, 1971.
* Croustilleries, margauderies et mignardises dans l'arrière pays normand au 18ème siècle par Simone Haster et Benoît de Macadamia. (Editions du Coq au Vingt, 1999)
* De la masturbation dextrogyre par les docteurs G. Manchette, V. Poinier et A. Soloman-Dolino. (La revue sexologico-médicale, n°117, octobre 2002)
* La procrastination chez les moines contemplatifs au XIVe siècle par Thibault Monfils (Edition du bilboquet 1897)
* La virginité réifiée par Monseigneur Foulifoulla (Edition Goupillette - 1757)
* Le pénis-elbow chez les sujets de plus de 40 ans en milieu rural par les docteurs G. Manchette, V. Poinier et A. Soloman-Dolino. (La revue sexologico-médicale, n°107, octobre 2001)
* Locutions molles et Prétérition en milieu rural bas-picard par Jean-Marie Golaud (Editions Picard et Ricard 1935)
* Pénétrations angulaires pendant le coït chez les bonobos par Madeleine Housson-Mesky (Revue du Zoo 6 de Frankfort, n° 813 mars 1960)
* Traçabilité d'une souris verte qui courait dans l'herbe par Simone Haster, Benoît de Macadamia et Kinapacé Tissoussi - Revue Mature 418, 145-151 (11 July 2002) | doi:10.1038/mature00879; Received 13 March 2002; Accepted 27 May 2002)
ListeDeListesLanceesParJeg
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!!%%Center(__Liste de listes lancées par Jeg__)%%
Liste de quelques unes des listes lancées par Jeg (classées par ordre de préférence)
* ListeDeListesLanceesParJeg :-) (mise en abyme...)
* ListeDeChosesAfaireAvantDePartirEnVacances
* ListeDeCaracteristiquesComparativesDuChinchard
* ListeDeDepartementsFrancaisImaginaires
** Ouaibmaistre ? tu peux nous départager ?))%%
* ListeDeDisparus
* Listes pas lancées par Jeg
*** µµSans causer de celles qui auraient mérité d'être lancées par lui ! -- à peu prés toutes celles du best-of, sans aucun douteµµ
* Pitin, quel rude paléographe vous faites. Je serais bien incapable de citer les listes que j'ai lancées µ(et j'ajoute que je me suis fait - plus d'une fois - solidement allumer sur des listes créées par d'autres darons...)µ
Liste inventée par Jeg (enfin, I presume, mon cher Stanley).
ListeDeChoseaFaireDansUnSupermarche
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Promenez-vous partout en regardant autour de vous et en fredonnant l'air de mission impossible.
* Quand vous entendez une annonce dans les hauts-parleurs, mettre les mains sur vos oreilles, se mettre en position du fœtus et criez : "Oh non! Pas encore ces voix dans ma tête !! "
* Si par malheur vous cassez un pot de mayonnaise, mais qu'il y a une dame âgée ou un minot sans ses vieux à proximité, n'ayez pas peur de taper un scandale en les accusant (en toute honnêteté)
*Dans le même esprit ListeDactionsOudeParolesQuiVousFeronsPasserPourUnDingue
ListeDeChansonsAuxParolesTrompeuses
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(__Liste de chansons aux paroles trompeuses__)%%
* __Agadou__ (Paroles et Musique : Mya Simille, Michel Delancray - 1981) : Agadou dou dou pouss' l'ananas et mouds l'café {2x}
* __Annie aime les sucettes__, les sucettes à l'anis. Les sucettes à l'anis d'Annie donnent à ses baisers un goût anisé. Lorsque le sucre d'orge parfumé à l'anis coule dans la gorge d'Annie, elle est au paradis. (Paroles et musique : Serge Gainsbourg 1966 - Chanté par France Gall) [http://www.noname.fr/cisco/Images/Tags/accueil/tag2a.jpg]
* __Du brie que l'on tient dans ses doigts et qu'on roule__ Ben non c'est du gris (du tabac gris en fait) Créé en 1920 (paroles de E.Dumont, musique de F.L. Benech. Popularisée en 1931 par Berthe Sylva
* __Quelque chose de Tennessee__ de Johnny Hallyday ne fait pas référence à l'état du sud des États-Unis mais à Tennessee Williams (pseudonyme que prit Thomas Lanier Williams en hommage à ses grands-parents qui vivaient dans cet État, à Memphis)
* __Arrête, arrête, ne me touche pas, Je t'en supplie, aie pitié de moi__ (Demain tu te maries, Patricia Carli - 1963) transformée en colo en ''Arrête arrête ne me touche pas, C'est pas ici, c'est bien plus bas.''
* __Bambino__ (1957, Dalida) L'amour et la jalousie, Bambino, Bambino, ne sont pas de jeux d'enfants, transformé en colo par ''La pipe et la sodomie, Bambino, Bambino, ne sont pas pour les gnians-gnians''
* __Sidonie a plus d'un amant__ (créée pour le film "Vie privée" de Louis Malle en 1961) sur un poème de Charles Cros. Chanté par Brigitte Bardot. Devenu : ''Si Denis a plus d'un amant, Qui lui tripotent bien le cul, C'est qu'il est bâti comm' Maman, Si Denis a plus d'un amant...''
ListePourDonnerUnNomAmonMajordome
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Rémi (parce que Majordome Rémi facho à Sido)
ListedeJeCommenceDemain
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
(parlé : « Et pis aussi, faudrait...
* que j'écrive au maire de Paris pour qu'enfin soit assurée la continuité des pistes cyclables et des chemins piétonniers le long des berges µµen le menaçant de ne plus voter pour lui la prochaine fois na !µµ
µµ Démarrée (et versifiée) par Jeg d'après : ([Je commence demain|http://www.paroles.net/texte/16555], JJ Goldman)µµ
µµ « Les étudiants et les étudiantes désirant prendre en main leur problème de procrastination peuvent s'inscrire (avant le 20 janvier) à un atelier de six rencontres animées par Anne-Louise Fournier, qui auront lieu les vendredis, de 9 h à 11 h 30, à compter du 23 janvier.-- de quelle année ? -- Pour ce faire, s'adresser au Service d'orientation et de counseling, bureau 2121, pavillon Maurice-Pollack, 656-7987. »  µµ
ListeDeJaiOublie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [J'ai oublié de viiiiiiivre|http://site.ifrance.com/leparolier/textes/jaioubliedevivre.htm] (à force de jeter mon cœur dans un micro (sic !))
** à part Fred Mella (facile à se rappeler puisque Edith piaf lui disait Vas-y Fred, Mets-là !")[http://francite.ru/images/08/f08_r07_04.jpg]
ListeDeMetonymies
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
La métonymie n'est autre qu'une figure de rhétorique par laquelle un concept est dénommé à partir d'un mot désignant un autre concept.
Il existe donc une relation obligée comme, par exemple, la cause pour l'effet, la partie pour le tout, ou le contenant pour le contenu.)%% Et la main de ma soeur ?
* ''On'' a gagné ! (Phrase de supporter si, par exemple, ''l'OM'' bat ''le PSG'')
* Ne convient pas : le prof de latin est une peau de vache : il s'agit là d'une comparaison, d'une assimilation.
** euh, c'est pas pour ramener ma science, mais ce n'est pas une comparaison, c'est une métaphore (annoncée) signé : un profess... ionnel qui passait par là) ;-)
ListeDeDiscussions
/* par PITIE ne mettez pas de liens vers de GROSSES discussions. merci
* Discussion en aparté : ''µµ''c'est elle la maîtresse de Robert !''µµ
ListedeDimanches
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Choisir la vie, choisir un boulot, choisir une carrière, choisir une famille, choisir une putain de télé à la con, choisir des machines à laver, des bagnoles, des platines laser, des ouvres boites électroniques, choisir la santé, un faible taux de cholestérol et une bonne mutuelle, choisir les prêts à taux fixe, choisir son petit pavillon, choisir ses amis, choisir son survet' et le sac qui va avec, choisir son canapé avec les deux fauteuils, le tout à crédit avec un choix de tissu de merde, choisir de bricoler le %%Red(dimanche)%% matin en s'interrogeant sur le sens de sa vie, choisir de s'affaler sur ce putain de canapé, et se lobotomiser aux jeux télé en se bourrant de Mac Do, choisir de pourrir à l'hospice et de finir en se pissant dessus dans la misère en réalisant qu'on fait honte aux enfants niqués de la tête qu'on a pondu pour qu'ils prennent le relais, choisir son avenir, choisir la vie.Pourquoi je ferai une chose pareille ? J'ai choisi de ne pas choisir la vie. J'ai choisi autre chose, les raisons... Y' a pas de raison. On a pas besoin de raison quand on a l'héroïne. [Trainspotting|http://movieweb.com/movie/trainspotting/]
* [les enfants s'ennuient le dimanche...|http://www.paroles.net/texte/14514] ''Jacques Prévert''
** Je sais pourquoi je déteste le %%Red(dimanche)%% : c'est parce que des gens, occupés à rien, se permettent d'être oisifs comme moi. - Jules Renard
** La meilleur preuve que les Français se lavent peu, c'est qu'ils paraissent beaucoup plus propres le %%Red(dimanche)%% ! Pierre Daninos
** Quand un mercredi démarre comme un %%Red(dimanche)%%, il y a quelque chose qui cloche quelque part - John Wyndham
** Le %%Red(dimanche est ennuyeux parce qu'il est dimanche)%% pour tout le monde - Georges Perros
* Sombre [dimanche|http://www.paroles.net/texte/22072/artis/1005]
* Un dimanche comme les autres (Al Pacino) µ(Pas du tout! C'est avec Murray Head et Glenda Jackson, entre autres ! Le film avec Pacino, c'est ''Un après-midi de chien'' !!! et le titre original est ''Sunday Bloody Sunday'', repris par la suite par U2!µ
ListeDeCeQuonPeutFaireAvecUnPorteManteau
/* par PITIE ne mettez pas de liens vers de GROS portemanteaux. merci
**µµs'il est en bois, parce que s'il est plastique ça va empester l'atmosphère et s'il est en métal ça va pas le faire...µµ
**''Elodie avait l'habitude de se livrer à des jeux solitaires à l'aide d'un portemanteau muni de pinces (il s'agit de modèles servant notamment à ranger jupes et pantalons dans les armoires) - Voulant se guérir de ces mauvaises habitudes elle invoqua le seigneur, celui-ci touché par tant de piété lui envoya un [ange|ListedAnges] avec pour mission d'écraser de ses doigts le portemanteau malfaisant'' [http://www.godefroy-de-bouillon.com/accueil/reims/ange.jpg]
* A l'heure de la mort, je ne sais pas ce que vous ferez, Messieurs, - répondit lentement Mesnilgrand; - mais quant à moi, avant de partir pour l'autre monde, je veux faire à tout risque mon __portemanteau__. (Jules Barbey d'Aurevilly - Les Diaboliques)
ListeElectoraleDeParisCinquieme
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(Liste électorale de Paris Vème)%%
*Aux élections municipales de 2008, partout, les instituts de sondages ont été capables de donner le vainqueur sur la simple base du dépouillement des 100 premiers bulletins de l'ensemble des bureaux. Il n'y a a eu aucune erreur (même là où le résultat a été extrêmement serré...) sauf à Paris Vème où tout les instituts donnaient Tiberi battu, alors qu'il fut élu ! Alléluia !
*µµStupide et sans aucun intérêt, mais du même tonneau que les "[1000 merci|ListeDeMilleMercis]" ou la "[liste des caractères spéciaux|ListeUtileDeCodesNecessairesaLaScriptionDeCaracteresSpeciauxEtNotammentAlAccentuationDesCapitales]" (vous savez, celle avec pleins de petits carrés partout)µµ
*µµJe proteste: toute liste où l'on parle de moi est intéressante (GB)µµ
ListedeCiels
/*Par pitié laisser le ciel tranquille
** ce que ça me parle cette expression ! [http://www.paleospot.com/croquis/panoluco.jpg]
* Le ciel est par-dessus le toit si bleu si calme
* Les [chevaliers du|http://www.telecharger-paroles.com/frame/redirect.php3?url=http://www.telecharger-paroles.com/chanson_fr/data/Luis%20Mariano/luis_mariano09.htm] ciel (l'allure franche et décidée, l'air souriant le regard droit)
* les cent ciels (librairie parisienne...)
Paroles de chansons
* "Avec un ciel si bas qu'un canal s'est perdu, avec un ciel si bas qu'il fait l'humilité, avec un ciel si gris qu'un canal s'est pendu, avec un ciel si gris qu'il faut lui pardonner..." [(Jacques Brel)|http://mirabilia.r&3117;/brel/pays.html]
* Quand soudain, semblant crever le ciel / Et venant de nulle part / surgit un kilo de poires... (Barbara)
µµrestaurée et reclassée par l'ange venu du cielµµ
ListeDeChosesQuiSontTrois
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Balthazar, Melchior et Gaspard. [http://www.jecollectionne.com/upload/visuel/GASPARD_MELCHIOR_ET_BALTHAZAR.JPG]
%%Center(µµParc Louis Jouvet, 95400 Villiers le Belµµ)%%
* Consulat : Bonaparte, Siéyès et Ducos
** Ou en synthèse additive : rouge, vert et bleuµµ, comme sur le drapeau de la Namibie par exempleµµ [http://atlasgeo.span.ch/flags/animations/Namibie.gif]
* Dario, Mimile et Pipo ''(Bonjours les p'tits enfants... Ah lala lala lala...)'' [http://www.partyoutfitters.com/itempics/games/CLOWNS.JPG]
* Les [garçons dont le chant emplit ma maison| http://www.mathabos.com/Chansons/3garcons.htm] (dire que je chantais ça à l'école primaire avec M. Meyer (Dieu ait son âme) et sa mandoline, il y a 25 ans...) ! µµhi ! hi ! moi aussi !! mais pas avec M. Meyer µµ µ( oui mais ils repartent quatre)µ
* Les Marx brothers: Groucho, Harpo et Chico (Gummo et Zeppo n'ayant pas suivi la carrière, et sans parler du cousin Karl)[http://www.cyber-cinema.com/classic/marxBClass.jpg]
* Les parties du discours, inventio, dispositio et elocutio (en fait non, ce sont des parties de la rhétorique, qui en comptait cinq, avec memoria et actio - mais on peut les remplacer par introduction-développement-conclusion)
* Les sœurs Vladys Marina, Versois Odile et ... ? (j'chaipu) qui ont joué ensemble les 3 soeurs de Tchekov à Paris...µµmeme qu'il parait qu'elles sont 4 v'la autchose!µµ* Les trois souhaits, dans plusieurs contes
* Les trois cloches (Edith Piaf avec les compagnons de la chanson, puis beaucoup plus tard, reprise par Tina Arena)
* Les trois Glorieuses (27, 28 et 29 juillet 1830) [http://www.linternaute.com/paris/magazine/photo/paris-en-noir-et-blanc/image/bastille-292093.jpg]
* les trois Parques : Clotho, Lachésis, Atropos
* Les trois tétons de Francisco Scaramanga, le tueur joué par Christopher Lee dans "l'homme au pistolet d'or", film des aventures de James Bond datant de 1974.
* Madame xxx souhaitait rencontrer Marcel Aymé. Aussi elle demande à une de ses amies qui le connaissait d’organiser un dîner. Son amie la prévient que l’écrivain est renfermé et bien peu bavard. Qu’à cela ne tienne, l’admiratrice se fait fort de susciter la conversation. A la fin du repas, Marcel Aymé n’a pas daigné ouvrir la bouche (sauf pour manger s’entend !). Madame *** supplie alors de dire quelque chose : « J’ai parié que vous diriez au moins quatre mots » lui dit elle, « vous avez perdu » lui répond Marcel Aymé
/* Three blind mice [http://www.threes.com/image/bmice.jpg] et autres [comptines anglaises|http://www.threes.com/storybooks_book.html] avec des animaux qui marchent par 3 (pigs, bears, etc...) - liens mort et rien trouvé pour remplacer
* Trimammophilie (ou trinichonophilie) : Fantasme de la femme à trois seins. On retrouve la trace de ce fantasme très ancien dans certaines légendes celtes, notamment celle de Sainte Gwenn (Blanche) en Bretagne qui enfanta de trois triplés, destinés à devenir trois saints, pour ce faire Dieu la dota d'une 3ème mamelle (ça ne s'invente pas). De l'Inde nous vient aussi la légende de la très agressive Meenakshi qui possédait des yeux de poisson et trois seins, (mais le 3ème disparut quand Shiva l'épousa). Paul Verhoeven en 1990 avec Total Recall a ressuscité le mythe en de très brèves mais marquantes images. Puis en 2004, les auteurs de la bande dessinée "Valérian" ont imaginé une belle aventurière à trois seins (Au bord du Grand rien)[http://lassilia.voila.net/Bonus/Trimammophilie.jpg]
* Trois [petits enfants qui s'en allaient glaner aux champs, dans la Légende de Saint-Nicolas|http://www.musicanet.org/robokopp/french/ilsetaie.htm] [http://www.club-j.be/clipart/saintnicolas2.gif]
* l'étroit mousquetaire : film parodique anglais --- pardon, c'est français môsieur et de Max Linder qui ne l'était pas moins, voir ce lien :http://www.dvdclassik.com/critique/l-etroit-mousquetaire-linder
µµcrée par Onsépaki mais reclassé et restauré par B. Nevol le 21/1/07µµ
ListeDeChosesAfaireSurCeWiki
!%%Blue(''parlons d'éthique...'')%%
Les participants viennent de différents pays et de différentes cultures, et ont des points de vue très différents. En traitant les autres et leurs avis avec respect, et dans un esprit de non-violence, nous pourrons collaborer avec plus d'efficacité dans la construction de la liste des listes.
*__Conseiller__ ce [lien|http://www.debilitron.com/debilitage/debilit.php?PHPSESSID=df49581bb729beb166ee44960a9a8f5c surmouche=debiliter force=1 target=http%3A%2F%2Fwww.echolalie.org%2Fwiki%2Findex.php%3ListeDeChosesAfaireSurCeWiki], qui, lorsqu'il marche, donne à mon wiki préféré un parfum de cham*pignon. Lorsqu'il ne marche pas on tapotera à cette [adresse|http://www.debilitron.com/].
* __Compléter__ les parenthèses et les % oubliés provoquant des textes bizarres à l'écran
* __Consulter__ celles qui sont le plus consultées __MostPopular__ ou __Hit Parade__
* __Parcourir__ les listes alphabétiquement __AZ__ ou __ListeDeAaZ__
* __Rechercher__ [une liste classée par thème| http://echolalie.free.fr/wiki/index.php?ListeThematiqueDeToutesLesListes]
* __Repérer__ les listes qui viennent d'être créées ou modifiées __ListeDesNouveautes__ et par qui __RecentChanges__ ou __Détails__ ou __Visiteurs__ ou __ListeDeVisiteurs__
*__Retrouver__ les Listes Disparues En [Janvier|http://240plan.ovh.net/~echolali/wiki/index.php?ListeDeListesDisparuesEnJanvier] (''deux sont encore manquantes'')
* %%Red(__Vérifier__ les liens)%% et anéantir sans pitié ceux qui sont périmés, éventuellement les remplacer par des liens frais.
* Piller des listes existantes pour en faire une toute neuve (tel le hachis parmentier)
###££([4|http://www.echolalie.org/wiki/index.php?ListeDeChosesAfaireSurCeWiki#quatre])££### : Chpeux pas changer, le ###blue### ça fait partie de ma marque de fabrique... ###Kindofblue###µµ
ListeDeBaisers
/* par PITIE ne mettez pas de liens vers de GROS bisous. merci
*L'amour humain ne se distingue du rut stupide des animaux que par deux fonctions divines : la caresse et le baiser. ''[Pierre Louÿs|ListePourPierreLouys]''
*Le baiser à été inventé par les amants pour s'empêcher réciproquement de dire des bêtises''. ''Tristan Bernard''
*Le premier baiser qu'on obtient d'une femme est comme le premier cornichon qu'on parvient à extraire du bocal. Le reste vient tout seul. ''Mark Twain''
*Un baiser est un tour délicieux conçu par la nature pour couper la parole quand les mots deviennent superflus. ''Ingrid Bergman''
*Action de donner un baiser, ce qui consiste, avec ses lèvres, à faire une légère aspiration, suivie ou non d'un petit bruit de bouche, sur une personne, démontrant l'affection qu'on lui porte. Le baiser connaît également une variante à connotation plus sexuelle qui consiste à le faire sur la bouche d'une autre personne puis à faire pénétrer sa langue dans la bouche du ou de la partenaire qui peut en faire autant, appelé aussi baiser profond ou "french kiss" par les anglophones. Il y a aussi une variante maorie ou inuit qui consiste à se frotter les nez entre deux personnes.
%%Center(µµ__"le baiser" de Brancusi (cimetière Montparnasse ; on ira un jour ?)__µµ)%%
* [baisers (les)|http://www.paroles.net/chansons/11279.htm] - ya le baiser Zézette-euh, le plus salé, le plus sucré, c'est le plus chouette-euh... (Pierre Perret)
* de l'Hôtel de ville de Robert Doisneau[http://cache2.allpostersimages.com/p/LRG/8/859/88DJ000Z/affiches/doisneau-robert-le-baiser-de-l-hotel-de-ville-paris-1950.jpg]
* indien (définition courante) : Il s'agit d'un baiser pratiqué immédiatement après une fellation/éjaculation, celle (ou celui) qui a recueilli le sperme dans se bouche va en embrassant son partenaire lui restituer. Ce n'est pas si évident que ça d'autant que l'acte se déroule pour celui qui vient de jouir en pleine période de stress post éjaculatoire... mais il y a a des amateurs !
**indien (par Pierre Perret) : On s'embrasse trois fois sur le cul / Et on dit coucou tu m'as eu
*japonais (par Lio) ''extrait des souvenirs de Lio (ref du livre "Pop Model" co-écrit avec Gilles Verlant)'' : Gainsbourg s'assoit à coté de moi sur le lit. Et le voila qui veut m'apprendre le baiser japonais. En fait, c'est un genre de blague, il faut plaquer ses lèvres sur celles de votre victime et lui souffler dans la bouche. Et après, si le cœur vous en dit transformer le baiser japonais en roulage de pelle réglementaire...
**japonais (par Pierre Perret) : On avale un grand bol de lait/On s'embrasse trois fois sur les seins / Et puis on dit plus rien
** Le bisou le plus long du cinéma : pendant longtemps celui échangé par Cary Grant & Ingrid Bergman dans Notorious (Les enchaînés d'Hitchcock) µ([deux minutes trente|http://echolalie.free.fr/wiki/index.php?ListeDeBaisers])µ, puis Steve Mc Queen & Faye Dunaway dans L'affaire Thomas Crown (mais peut-être le record a-t-il été battu depuis ?)
** Pas sur la bouche - Opérette en 3 actes de Maurice Yvain, Livret d'André Barde (1925) Porté au cinéma en 2003 par Alain Resnais [http://www.filmdeculte.com/photo/film/passurlabouche/image.jpg]
* par Rodin [http://shakti.canalblog.com/images/Le_Baiser_Rodin1.jpg]
* Deux heures de colle pour un baiser - (un film allemand de 1978). un film de : Andre Farwagi. comédie - 1h35. avec : Nastassja Kinski, Gerry Sundquist, Veronique Delbourg, Stefano D'Amato. Envoyés en Suisse par leurs familles respectives, Debbie et Fibs se rencontrent dans le train. Comme ils sont très épris, il vont passer leur temps à tenter de tromper la surveillance des professeurs pour se retrouver en cachette. (ce film n'est pas à l'affiche actuellement. C'est dommage, parce que le résumé, ça donne vraiment envie :-))
* Tout commença par un baiser - 1959
* La malédiction des 1000 baisers par Sax Rohmer [http://www.njedge.net/~knapp/BAISERS.JPG]
* Le baiser n'est pas une pratique universelle. Les tribus africaines Chewa et Thonga, en voyant des Européens s'embrasser, disent: "Regardez, ils mangent l'un de l'autre leur sale salive" (2). Parmi de vastes tribus de nombreux pays (Bornéo, sur le fleuve Gambie en Afrique occidentale, en Birmanie, en Sibérie, en Inde), le mot pour "embrasser" signifie sentir. Un baiser est en fait une manière de sentir longuement son aimé, un parent, un ami.
* Les Chinois étaient offensés par la simple idée d'embrasser et voyaient cela comme une forme de cannibalisme. C'est une attitude qui persiste dans certaines parties du monde.
** Chez les Chinois, embrasser quelqu'un est l'équivalent d'une relation sexuelle. C'est un geste qu'on ne fait pas à la légère et, surtout, pas avec n'importe qui. Les Chinois ont aussi très peur de la contamination par le baiser. Par la bouche de leur partenaire, ils ont peur d'attraper des maladies... [http://lenaweb.voila.net/asian_fk.jpg]
* Dans certains pays d'Afrique, on croit que la bouche est la principale sortie de l'être vers l'extérieur. Ainsi, dans la logique de cette croyance, le baiser devient presque un geste dangereux parce que, à chaque bisou, on risque d'échapper son âme avec son souffle !
* Dans certaines tribus du Niger, les «embrasseurs ou embrasseuses» sont même punis. Si l'on vous surprend à bécoter quelqu'un, vous risquez de passer au fouet. Et ce n'est pas des blagues... Rien n'empêche de le faire en secret par contre...
* Connaissez-vous les «becs d'esquimaux» ? Ces bécots qu'on se donne en se frottant le bout du nez? Et bien, il n'y a pas que les esquimaux qui s'y prennent comme ça! Les Polynésiens, eux aussi, se frottent le bout du nez lorsqu'ils sont amoureux! En fait, en se frottant contre le visage de l'autre, le but est de s'imprégner du parfum de sa peau.
/*la plupart des liens html sont obsolètes.
A.µµsponsorisée par Bourjois avec un j comme Joieµµ
ListeDeVillesOuOnTrouveDesColonnesMorris
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
*Bruxelles, dont au moins une est un WC (square Marie-José, Ixelles, mais elle est partie)
*Paris
µµListe créée le 26/03/2007 vers les 17h18 par Madeleine.µµ Oh Madeleine ! Finalement, tu es venue ? µµOui! J'avais envie de manger des frites chez Eugène!µµ
ListeDeProblemes
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
restée constante et que la colonne a parcouru 50 m, quelle est la distance
parcourue par le chinchard ravitailleur ?
*** il fait 100 metres par rapport aux autres chinchard : d'abord 50 metres pour remonter la colonne, puis 50 pour la redescendre.
*** il fait 3000 metres parce qu'il est porté par un courant qui le déplace d'autant pendant sa manoeuvre
Le rayon d'action (distance maximale pouvant être parcourue sans ravitaillement ) d'un 4X4 est R km , car il a un réservoir de R litres, et il consomme un litre au kilometre .
Quelle est, en fonction de R, la distance maximale D que peut parcourir un 4X4 si au départ du Dakar démarrent 7 (sept) 4X4 identiques aux réservoirs pleins. On suppose les pilotes Ah Que ! coopératifs.
** O kilométre parce que les anti 4x4 ont les ont brulés avec l'essence disponible !
ListeDeMaximes
/*Par pitié... air connu
** µµhonte aux autorités municipales de cette station qui ont interdit les seins nus hors des plages... sous peine de verbalisation par des gorilles infréquentables. allez plutôt à St-Trop, ce n'est pas plus cher et au moins là, on sait ce que décontraction veut dire...µµ[http://lassilia.voila.net/Bonus/abdosnudiste.jpg]
**µµIl va falloir finir par utiliser ces trucs que sous prescription médicaleµµ
SuiteDeHistoireDeListesTrois
/* PAR PITIE SVP NE METTEZ PAS DE GROSSES IMAGES MERCI */
%%Small(Chaque visiteur peut rajouter une phrase à l'histoire (ou paragraphe si c'est pas trop long. Attention aux tricheurs). On ne modifie pas les textes des interventions des autres (sauf faute d'orthographe), mais comme d'habitude sur ce wiki, on peut rajouter des liens sur le texte.)%%
%%Small(Il est possible de revenir autant de fois qu'on veut, à condition de laisser au moins une ligne écrite par un autre.)%%
µRésumé : Aprés avoir sauvé les chinchards d'une mort certaine, Antoinette, Clara, Jack et Alain Rey doivent sauver le premier Ministre de La France, enlevé par Georges Brougnard. Ils sont dans un canot µµ%%Red(''mais non, maintenant ils sont à bord du ravitailleur, même qu'ils ont oublié les chtoucas dans le canot...faut suivre quand même'')%%, au milieu de la mer Noire, aprés le naufrage du Charles De Gaulle. Le chanoîne Blorer a momentanément disparu.µ
µ(''Rappel : le Chinchard©®, pure merveille technologique nippone est le cadeau de départ offert à Jack par ses collègues...'')µ
# le premier, "[Inventaire de 1792|http://www.aulps.com/inv.php]" dressait l'inventaire ''(encore une liste!!)'' des objets ayant appartenu en 1792 à l'abbaye [Notre Dame d'Aulps|http://www.aulps.com/] (Haute Savoie)
# les deux suivants affichaient des extraits de texte de Gautier : "[Celle-ci et Celle-là ou la Jeune France passionnée|http://pot-pourri.fltr.ucl.ac.be/files/AClassFTP/Textes/Gauthier/jeunes_france_celle_ci.txt]" et "[la toison d'or|http://pot-pourri.fltr.ucl.ac.be/files/AClassFTP/Textes/Gauthier/toison_or.txt]" mis en ligne par la prestigieuse université de LOUVAIN ''(Belgique)''
%%%"oups, pardon ! Que désires-tu cher ami ?"
%%%En deux mots Jack lui énonca l'énigme et les 5 solutions proposées par Google. "Alors Jeg d'après toi quelle est la solution ?" L'enjeu est de 1 000 000 d'euros oups ! non ! l'Avenir de la France !!!"
%%%"Et s'il s'agissait d'un piège grossier ?" intervint Jeg qui étant au téléphone, était le seul à ne pas avoir eu les épaules zébrées par les coups de fouet.
%%%"Mais oui" expliqua-t-il "ne sous-estimons pas l'intelligence de notre adversaire qui, bien que supporter du PSG, nous a démontré plus d'une fois les turpitudes dont il était capable. Rappelez vous le hacking de notre site ! A première vue en effet, Anatole France paraît la bonne piste. Mais c'est pour nous enduire d'erreur. Comme "l'abbé Mouret" qu'il a fait figurer deux fois et comme "Théophile Gautier" pour la même raison et les dispositions tarifaires ne sont là que pour mieux nous y engluer. Ne tombons pas dans le panneau ! Maintenant c'est clair ! Le premier Ministre est retenu prisonnier à l'abbaye d'Aulps !!!
Quel endroit en effet est plus propice et plus discret ? Quelqu'un ici en a-t-il même déjà entendu parler ?"
%%%"Quelqu'un ici en a-t-il même déjà entendu parler ?!!!" reprit-il un ton plus haut.
%%%"Revenez au site de l'[abbaye|http://www.aulps.com/inv.php] " stupéfiant tout le monde par la capacité de sa mémoire visuelle.
%%%Antoinette était tellement absorbée par ce qui se passait qu'elle ne se rendait même pas compte qu'Alain Rey était en train de vérifier que son sein droit avait les mêmes qualités que son sein gauche.
"Le seul hélicoptère de cette histoire, c'est celui qui a emmené Cédrichounet ... pardon, l'amiral Cédroc, il n'y en a pas d'autre"
L'amiral Cédroc restant hélas définitivement injoignable, il n'eurent plus comme solution que de faire appel aux hélicoptères de [« la Carte aux Trésors », la célèbre émission de France 3 animée par Sylvain Augier| http://france3.francetv.fr/emissions/carteauxtresors/index.htm].
[« la Carte aux Trésors », la célèbre émission de France 3 animée par Sylvain Augier| http://france3.francetv.fr/emissions/carteauxtresors/index.htm]
%%%-parce que c le MIEN ! dit tout simplement Sylvain Augiers.
Jack sentit, avec la préscience confuse d'un illuminé dévasté par les forces du mal, que cette histoire ne tournait pas bien. Il prit les seules et sages décisions qui s'imposaient :
"Clara, montez dans l'hélicoptère blanc. L'amiral vous attend - Il vous aime, vous le savez - Au revoir amie. - Alain, vous prenez l'hélicoptère rouge. Vos Roberts vous attendent. Merci pour tout. Antoinette, [secouez|http://www.echolalie.com/antorse.htm]-vous, nous prenons l'hélicoptère bleu, et allons nous reposer quelque temps dans votre [chateau|http://www.echolalie.com/feuille.htm] de Longe-Longe les Prés. Quant à J-P R., il peut attendre un peu. Le Ministre de la construction des prisons est en train d'édifier un centre pénitenciaire à l'abbaye d'Aulps. Ils finiront bien par le trouver. Penser à prévenir Jeg de la fin heureuse de notre aventure. Sans lui rien n'aurait été possible. Je crois aussi que MAM ne lui est pas indifférente. Et puis c'est la rentrée, il faut bien que nos aventures prennent fin. Sentez-vous, amis, ces ondes bonifiantes qui inondent nos chakras?. Quelque part, l'anachorète Blorer prie pour nous. Que les [chtoucas|http://echolalie.free.fr/wiki/images/chtoucas.htm] soient avec vous. "
En tout cas était-ce là la version de l'A.F.-P. relayée fidèlement dans les chaumières par les télévisions ... Mais selon le Journal d'Echolalie, il semblait que le voyage eût été plus agité. Dans l'hélicoptère bleu, pris par la nostalgie de ses propres qualités ou bien mû par l'impérieux devoir d'épater sa voisine de cockpit dont il restait séparé par le manche à balai, l'amiral Cédroc eut l'idée saugrenue de faire la vigie. Sa touffe en fut écrétée au point de laisser apparaître une tonsure qui le rendit si ressemblant au prélat Préli que Sylvain Augier fit adresser le chèque du vainqueur au religieux plutôt qu'au militaire. N'eût été l'intervention préventive de Jack.T, qui avait pourfendu la mécanique de l'engin volant de son bédane de manière que ses pales en furent surélevées,le dignitaire de la marine serait passé de vie à trépas.
Ayant eu vent de cette confusion,l'anachorète Blorer se mit en tête de restituer son dû au vainqueur et téléphona à son frère, brigadier à la gendarmerie d'Aulps, pour qu'ils retrouvassent le prélat. Les frères se réunirent autour d'une toupe, au bar de la gare d'Aulps, et parlaient de l'abbaye.
Unis et bénis par le vieux Jim et toute la[famille|http://www.angelfire.com/tx/LittleHouse/], Jean et Suzanna d'Entrevaux ont connu, après leur temps d'épreuves et d'émotions si vives, le bonheur calme, la joie paisible sous un azur inaltéré.
%%% %%Blue(µ''NAN!!! comment est-ce-que je vais faire pour pedre mon temps sur internet maintenant! il faut continuer l'histoire il y a enormement de gens qui sont frustrés de ne pas pouvoir participer a cette histoire(si,si!) maintenant qu'elle est finie...''µµ)%%
%%%''µContribuent dynamiquement, créativement, esthétiquement, intelligemment, humoristiquement, chaudement, sensuellement, en permanence ou épisodiquement, à cette histoire - initialisée par Clara - les autrices(eurs) suivant(e)s :µ''
%%Blue((''et moi je voudrais bien qu'on m'oublie un peu !!...''))%% %%Green(µµ('' et pour les [cours particuliers|http://echolalie.free.fr/wiki/index.php?ListeDeFilmsQuonAimeraitVoir] alors ?'')µµ)%%
SuiteDeHistoireDeListes
%%Small(Chaque visiteur peut rajouter une phrase à l'histoire (ou paragraphe si c'est pas trop long. Attention aux tricheurs). On ne modifie pas les textes des interventions des autres (sauf faute d'orthographe), mais comme d'habitude sur ce wiki, on peut rajouter des liens sur le texte.)%%
%%Small(Il est possible de revenir autant de fois qu'on veut, à condition de laisser au moins une ligne écrite par un autre.)%%
Laissant-là cette pensée parasite -sans doute émise par l'un des Grands Anciens qu'il avait eu l'impudence d'invoquer- il s'activa et composa l'adresse de son ami Google sur la petite merveille nipponne.
... et puis disparut, cette bande d'imbéciles du bureau avaient oublié de changer les piles !
Il jeta un coup d'oeil à A.R. Tous comptes faits, il était beaucoup moins bien que sur les photos... (''Penser à en toucher un mot à A., C., J., M., O., S...'' ). Sur la poche de son blazer, Jack reconnu le sigle "A.T.L."; que signifiait-il ? En attendant de répondre à cette importante question, les deux hommes prirent la fuite (du latin fugitus) - car la Porte avait été ouverte par les Grands Anciens - , et se retrouvèrent à [Bur|http://echolalie.free.fr/wiki/index.php?ListeDeBurnes]e-Sur-Yvette devant un établissement connu : "Au rendez-vous des amis d'Alain Rey"
"Et puis elle a confondu avec la méthode [Boscher|http://www.cndp.fr/cdlect/visite/parent.htm]..alors..."-Sa voix se brisa- " Vous connaissez la suite.."
"oh si! qu'est-ce que je suis ? un bon à rien ! tout juste capable d'expliquer des mots que personne n'emploie dans un dictionnaire que personne ne lira jamais... et d'en parler sur une radio que personne n'écoute..."
Jack ralluma son Chinchard©® (dont il avait eu la présence d'esprit de recharger la batterie au bar des amis) et glissa une disquette dans l'orifice idoine qui l'engloutit voluptueusement. %%Red(''hum ! hum ! Oups ! pardon !'')%%
"Jack, est-ce bien le moment de se perdre en ronds de jambes ? Dites Ministre tout court et allez droit au sujet, n'oubliez pas que ma vie ne tient qu'à un fil ! - D'ailleurs dans ce cas, ''Le Ministre'' convient parfaitement. Savez-vous d'ailleurs que ''ministre'' vient du latin ''minister'' qui lui même ..."
par un réflexe ancien, Jack rugit " Ni Dieu Ni Maître ! Orthographe opium du peuple ! Pas de répît pour les petits chefs ! "
%%%"Pardonnez le dérangement. Je suis le Professeur Gaston Blorer, inventeur indépendant et à la retraite, et j'ai peut-être la solution à votre problême ..."
%%%Il ricana..."Oui vous aider peut-être je peux, jeunes listins...[Réfléchissez|http://www.mcs.surrey.ac.uk/Personal/R.Knott/Fibonacci/fibnat.html#Rabbits]" un couple de lapins étant dans un espace clos, combien de couples de lapins peut-il engendrer en un an, sachant que chaque couple donne naissance à un nouveau couple à partir du deuxième mois ?
Jack était consterné : d'une part, cette histoire était aussi connue que celle de l'éleveur de [poissons|http://mapage.noos.fr/echolalie/l1212.htm], et en plus, il avait bien conscience que cette HistoireDeListes n'avait ni queue ni tête...car la liste de [suites|http://www.echolalie.com/l1124.htm] avait déjà été publiée sur Echolalie. Il tournait en rond ! avec Alain Rey !
Et il disparut en courant.
Une fois dans l'avion, MAM pris la parole :
" Voici pourquoi je vous ai fait venir jusqu'ici :un gigantesque complot international se trame, et vous seul pouvez sauver le monde. Il ne s'agit pas moins que d'une entreprise terroriste globale et totalitaire visant à exterminer tous les chinchards de la planète. Demain des milliers de tonnes de poison CHINKLON-9B seront déversés dans tous les océans de la Planète. Vous seuls pouvez faire quelque chose. Le Charles-de-Gaulle, enfin réparé, est à votre disposition. Bon, on va faire le point dans ma cabine privée avec Alain".
%%% "Ah non, pitié, pas lui" gémit Alain Rey
%%% "Excusez-moi de vous demander pardon, mais de quoi s'agit-il ?" demanda Alain Rey
%%%"''Je ne ne peux plus rien y faire. Dites lui que je pense à elle, quand on me parle de magnolias. Dites lui que je suis comme elle, que j'aime les chansons, qui parlent d'amour et d'hirondelles''" - Jack était envouté, d'autant plus que MAM était toujours dézippée.
%%%"''Est-ce par hasard si j'ai croisé ton regard? Est-ce par hasard si cette nuit une étoile brille au dessus de nous comme un espoir ?''" MAM frissonnait
"''Je dormais dans son cooooorps, bercé par ses "Je t'èèèèèèèèèèème''".
ListeSombre
/*par pitié pas d'images trop sombres...
* sombres héros de l' [amer|http://www.noirdez.free.fr/Noirdez/Paroles/D2_Ame/SombresHeros.htm] qui ont su traverser les océans du vide...
* [Sombre parc|http://www.chez.com/sandranne/sparc.htm] ! µµ(étonnant :))µµ
ListeRose
/*Par pitié faites attention aux flamants roses !
* Couverts tous roses [http://www.parties-direct.com/images/06-pretty-pink-cutlery-cop.jpg]
* Les [fesses roses|ListeDeMotsRelatifsAlaPartiePosterieuredesHumains]
** Mais si on en boit trop, on finit par voir des [http://www.artbywicks.com/pink%20elephant.jpg]
* Sub rosa [http://pagesperso-orange.fr/apparition/photos/etoil.jpg]
* Un parti politique...µµ((RIP))µµ
µµCréé par Damien P. - Perdue, puis retrouvée par l'Equipe Technique - 3 ingénieurs ont été suspendus pour FPG -'' Ouf, merci :) - Liens morts épurés le 12/12/05 J'en ai remplacé certains mais pas tous, certains semblent carrément introuvables - Liens morts remplacés le 21/1/07 - itou + reclassement le 8/11/07 !µµ
ListeDesHommesQuiSontAllesSurMars
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Jeanette Pointu et ses compagnons - Par Wasterlain (Mission sur Mars)[http://pagesperso-orange.fr/lemomo2/Jeanette2.jpg]/*vous pourriez au moins vérifier si vos liens fonctionnent, monsieur le martien.... / chez moi ça fonctionnne -- ça fonctionne parce que l'image est dans le cache internet de votre DD. Faites plusieurs fois F5 pour raffraichir la page et vous verrez que vous ne la verrez plus. Par ailleurs vous êtes prié de laisser mon image tranquille, elle ne vous a rien fait !
ListeDeRecettesDeCuisineLitteraire
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Le poisson de Paris
* Gras (double) à La Parkinson
* "E" à la coque µ(tous ceux virés de la "disparition"...)µ
* Notre Edam de Paris
* Le parfait de la dame en noir
* les Munster de Paris
* Charlotte de Parme
* Paris (Br)est une fête
* Chartreuse (de Parme)
* Expresso du Nord, servi par un inconnu
*Gras (double) à La Parkinson = Par Ki son' le gras (pour qui sonne le glas)
**µ Château Calon-Ségur ⇝ ça, c'est effectivement le nom d'un Saint-Estèphe 3° cru classé, sans doute là parce qu'il évoque le nom de la comtesse (à confirmer).µ
ListeDesMomentsParfaitsDeLaJourneePourUnHomme
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(__Liste des moments parfaits de la journée pour un homme__)%%
*07.00 : Petit déjeuner : rumsteck et oeufs, café et toasts, préparés par la femme de ménage à poil.
*17.00 : Retour en jet privé, massage de tout le corps par Pamela Anderson
* Ici encore (voir la ListeDesMomentsParfaitsDeLaJourneePourUneFemme) on trouve une image très valorisante de l'homme... Ces listes se veulent peut-être humoristiques, en attendant je les trouve plutôt vulgaires.
ListeDeSeulementAuCanada
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeLeurres
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* L'avion japonnais trouvé le 16 avril 1945 par l'armée américaine ** µµtricoté avec amourµµ[http://www.de220.com/Strange%20Stuff/DECOY-80G313344.jpg]
* Les systèmes d'irrigation gonflables en Italie du sud pour toucher les subventions de la PAC (qui procède à des vérifications par photo aériennes)
ListeDeCommentairesQuiNousFontUneBelleJambe
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Sur Echolalie, on s'instruit en s'amusant : %%Red(Almanach)%% (de l'arabe al, le, et manach, compter, ou terme d'origine syriaque, signifiant l'année prochaine), petit livre qui commence par un calendrier, auquel on adjoint ordinairement les phases de la Lune, et quelquefois les heures du lever et du coucher du Soleil, de la Lune, et des principales planètes visibles, etc., et finit par un recueil de recettes, d'observations plus ou moins justes touchant l'agriculture, les saisons, les lunaisons; de prédictions sur les variations du temps, et autres indications qui ont la prétention d'être utiles dans les usages de la vie.
* En langue recherchée (pédante grogneront certains) on parle de mots autologiques ou hétérologiques
ListeDeJacquesLouisDavid
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
%%Green(*1800-1814 - Leonidas au Thermopyles)%% Thermopyles signifie en grec les portes chaudes - petit moyen mnémotechnique : Léonidas (comme la marque de chocolat) aimait le chocolat. Il part donc à la porte chaude comme le chocolat.
Ce tableau a été interrompu en 1800 car Napoléon Bonaparte victorieux à Marengo l'envoya chercher pour qu'il peigne pour lui. Il est terminé en 1814 car les commandes de Bonaparte sont prioritaires.
%%Green(*1800-1801 - Portrait équestre de Napoléon Bonaparte au mont saint Bernard)%%
%%Green(*1821 - Mars désarmé par Vénus et les grâces)%%
ListeDuTempsQuIlFautAvantDePouvoir
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Dès qu'un ours est pris, il est emmené dans un enclos connu par les habitants sous le nom de "prison des ours", où l'animal attend __le temps qu'il faut avant de pouvoir__ "être remis en liberté en toute sécurité dans la nature".
* Je vais subir la même opération que toi très prochainement et j'aimerai savoir combien de temps il t'as fallu avant de retrouver l'usage de ton bras ( __le temps qu'il faut avant de pouvoir__ réécrire par exemple )? (luxation des épaules)
* A titre d'info, un gros fournisseur de bois a son bureau d'études, et certains constructeurs (parfois pas des moindres) font appel à ce dernier. Le temps d'une visite dans leurs locaux j'ai vu défilé un bon nombre de charpentier qui venaient récupérer les "plans", les constructeurs ne se déplacent pas... quand on connait le prix des logiciels de calcul mais aussi __le temps qu'il faut avant de pouvoir__ le maîtriser...
* Ce temps, déterminé par la puissance de chaque sort, définit aussi __le temps qu'il faudra__ avant de pouvoir réutiliser le même sort. (Alchimie online)
* CPU-Turbo Mines 1 (CPU MINT01) - Prix: 5.000.000 Credits - Description: Réduit de 25 % __le temps qu'il faut attendre avant de pouvoir__ utiliser une autre mine ou un autre des articles générés par les mines.
* Le teck n'a pas eu autant de succès que le pin ou l'eucalyptus à cause de sa croissance relativement lente et par conséquent __le temps qu'il faut avant de pouvoir__ le récolter et amortir l'investissement.
**La fonction d'autocorrélation Rµµxxµµ(τ) est donnée par Rµµxxµµ(t,τ) :
* Pour __le temps qu'il faut attendre avant de pouvoir__ muter, tout dépend du département d'où tu souhaites partir et de celui dans lequel tu souhaites entrer. (Éducation nationale)
ListeDeCeQueJaiRetrouveDansLeBasDeMonVestiaire
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*8 gants en laine dépareillés
*un plan des bibliothèques de Paris 1995
**Ellroy James "Ma part d'ombre"
**Kerouac Jack "Le vagabond américain en voie de disparition"
****Ellroy James "Ma part d'ombre" ''en cours''
***Kerouac Jack "Le vagabond américain en voie de disparition"
µµdéménagé par A.µµ
µµEt pourquoi écrire si gros ce commentaire ?%%%Et pourquoi en plein milieu de la liste au lieu de proprement à la fin (-- ah ben, il n'est plus en gros+gras )? (je me suis permis de le déplacer sans le modifier par ailleurs)%%%Cette liste ne contient pas que des livres, mais les livres de cette liste appartiennent seulement à cette liste, je crois. J'ai compris ? (Jo)µµ
*** si ! ci-desssous y'avait que des livres maintenant cé ci-dessus alors cé plus vrai ! µµ-- ah d'acc, pardon. -- Ah ben où est passé le reste de mon vestiaire ?(A)µµ-
ListeDeLaThierache
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeMachinesPourMettreDesChosesDansDesSacs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Installations et appareils de conditionnement pour la confiserie
* Machines à emballer les sparadraps
* Ratatine-ordures, existe aussi en ratatine-ordures-ensachant, mais moins bon pour la [rime|http://www.paroles.net/texte/13210].
µµlisteµµ utile µµlistée par le secrétariat sur [demande express|http://www.echolalie.org/forum/viewtopic.php?t=60]µµ
ListedesseptPechesCapitaux
/*Par pitié... par pitié... par pitié...
*3bis) La Jalousie est parfois citée à la place de l'envie [http://www.poster.net/valadie-jean-baptiste/valadie-jean-baptiste-peches-capitaux-la-jalousie-4704710.jpg]
**on pourrait également parler des vertus des bas de contention
*6) La [paresse|ListeParesseuse]
**La vertu opposée est la %%Green(diligence)%% (µµtagada, tagadaµµ) et %%Green(l'ardeur dans le service de Dieu)%% (je l'aurais pas trouvée tout seul celle-là). µµC'est vrai que c'est handicapant pour entreprendre de grands projets et réussir sa vie, mais une petite grasse mat' par ci-par là...µµ
[http://lenaweb.voila.net/Valotton_La_Paresse.jpg][http://www.poster.net/valadie-jean-baptiste/valadie-jean-baptiste-peches-capitaux-la-paresse-4704708.jpg]
* Alors quand le prêtre lui parla des 7 péchés capitaux, la voluptueuse Elodie excédée, l'envoya aux fraises, ne se doutant pas qu'aux yeux effrayés de l'homme d'église, elle s'enfonçait alors encore un peu plus dans le ''pêcher'' :)[http://lassilia.voila.net/Bonus/fraise.jpg]
* µ[comparatif|http://altameter.x42.com/?q=orgueil+col%E8re+envie+luxure+avarice+paresse+gourmandise] sur le netµ
ListeDeNeDitesPas
/*Par pitié, ne me dites surtout pas que vous aller coller des grosses images !
**µµNe dites pas ''" Quelle bassesse de mettre une telle photo !''" , mais ''" __moi__, __personnellement__, __pour ma part__ et __en ce qui me concerne__, __je__ ne trouve pas ça bien.''" µµ
*Ne dites pas ''" Bon, il est 4 heures du mat', je suis crevé, vous vous barrez de mon appart, j'ai encore toutes vos saloperies à ranger, moi !''" mais ''" Ça va la soirée à été bonne ? On se fait un petit 1/4 d'heures vaisselle-ménage ?''"
*Ne dites pas ''" Il a participé''" , dites : ''" Il est parti pisser''" .
*Ne dites pas ''" J'ai tout perdu à la Bourse''" mais ''" Je suis parvenu a anticiper la fin du capitalisme''"
*Ne dites pas ''" Je reviens, je vais aller pisser un coup''" mais ''" Ma chère, je vous demande pardon de m'absenter un moment, je m'en vais de ce pas tendre la main à un ami intime que j'espère pouvoir vous présenter après le dîner''" .
*Ne dites pas ''" Ma parole, mais t'es toujours aussi con''" mais ''" Ce qui me fascine chez toi, c'est ta constance''"
*Ne dites pas ''" Mélodie en sous-sol''" mais ''" Gare notre voiture au parking''"
*Ne dites pas ''" Minnesota''" , dites : ''" Mon chat s'est échappé par la fenêtre''"
*Ne dites pas ''" Qu'est-ce à dire''" mais ''" Haut-parleur''"
*Ne dites pas ''" Tu m'attends cinq minutes, je vais pisser un bock''" . quand vous draguez une femme et que vous faites une halte au troquet pour boire un pot, , dites : ''" Ma chère, je vous demande pardon de m’absenter un moment, je m’en vais de ce pas tendre la main à un ami intime que j’espère pouvoir vous présenter très bientôt''" .
* Évitez les comparaisons risquées. Ne dites pas : ''" Dur comme une pine, rond comme une couille, mouillé comme ma fente, salé comme du foutre, pas plus gros que mon petit bouton''" , et autres expressions qui ne sont pas admises par le dictionnaire de l'Académie.
* Ne dites pas, médisez. µµEt aux Antilles, on ''déparle''µµ
ListeAngoissante
/* par PITIE ne mettez pas de liens vers de GROSSES angoisses. merci
**"Tout ce qui est sur elle [[la terre] doit disparaître, [[Seule] subsistera La Face [[Wajh] de ton Seigneur, plein de majesté et de noblesse."
**"Quand la terre sera secouée violemment, et les montagnes seront réduites en miettes, et qu'elles deviendront poussière éparpillée"
ListedeCommeTousles
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Comme tous les __aéroports__ internationaux, celui de Genève est visité par des voleurs à la tire. Nous vous prions donc de veiller à vos bagages.
* Son Excellence était donc un jeune seigneur espagnol, vif, ardent, comme tous les __amants de sa nation__, que l'on croit froide et qui n'est que paresseuse ''Barbier de Séville''
* Ils se parlaient bien bas, comme font tous les __amoureux__
* Comme tous les __capitalistes__, il estimait la fortune une chose enviable, mais trouvait plus délicat de ne complimenter que par un signe d'intelligence à peine avoué, au sujet de celle qu'on possédait ''M.P.''
* Comme tous les __chefs de parti__, il avait un pull-over de couleur claire pour les universités d'été
* Comme tous les __conducteurs de 4 X 4__, il roulait à toute pompe, à travers tout, par dessus les obstacles, sans prendre garde ni aux piétons qui traversaient, ni aux animaux qui fuyaient devant lui à la lueur des phares [http://www.mungumby.com/images/access_01new.jpg]
* Comme tous les __débutants__, Freud eut en partage bon nombre de ces " nerveux " ingrats, mais, au lieu de se laisser rebuter par leur mauvaise réputation, il songea que leur cas valait peut-être la peine d'être examiné, d'autant que le praticien qui parviendrait à les guérir pourrait sûrement compter sur un rapide succès
* Comme tous les __Démons Majeurs__ et les Anges trop puissants leur capacité de se téléporter était bloquée par la Gardienne de Sigil.
* Comme tous les __écrivains__, Buzzati est un oiseau de proie doté d'un talent exceptionnel pour s'emparer du butin et le restituer avec une élégance incontestable
* Bien entendu, ce Monsieur ne m'a pas répondu. Il a sans doute parlé de ma lettre à Le Braz, son ami, et tous deux ont dû en rire ensemble, comme font tous les __fonctionnaires__, les administrateurs, les maîtres et les patrons, des plaintes qu'ils reçoivent de malheureux sans sous : ils se moquent bien des plaintes des exploités, des volés [http://www.prefecture-police-paris.interieur.gouv.fr/connaitre/Images/reforme_pup/Accueil.jpg]
/* [http://www.bdparadisio.com/angou99/baxter.jpg]
* "Oh arrête, ne me dis pas que tu ne penses pas au sexe toi aussi" "Comme tous les __garçons__. Mais je n'ai pas besoin d'en parler toutes les cinq minutes"
* Si Gamaliel revenait, il aurait lu Jacques Monod et il dirait peut-être : Jésus-Christ est un grand génie spirituel mais comme tous les __hommes__, il est le fruit du hasard et de la nécessité et tout cela disparaîtra et, tôt ou tard, on retrouvera le grand silence des galaxies
* Les Chi'ites disent que le Messager d'Allah" Mohammed est infaillible, il est immaculé avant et après le Message, tandis que nous les sunnites disons qu'il est infaillible lorsque il transmet le Coran, à part cela, il peut se tromper comme tous les __humains__
* Ainsi évoquera-t-il ses parents qui, "comme tous les __immigrés__ n'ont eu pour seul but dans leur vie que celui de faire de nous des enfants comme les autres". Rire : "Ils n'y sont pas entièrement arrivés !" ''JJ Goldman''
* Et pendant que mon devant était aussi ridiculement le sujet de leurs sarcasmes, le comte, intime partisan du derrière (malheureusement, hélas ! comme tous les __libertins__), examinait le mien avec la plus grande attention ; il le maniait durement, le pétrissait avec force ; et, prenant des pincées de chair dans ses cinq doigts, il les amollissait jusqu'à les meurtrir ''Sade Justine''
* Comme tous les __parents__, les parents lesbiens ou g*a*y doivent concilier travail et famille, joindre les deux bouts et apporter à leur enfant conseils et encouragements
* Et pourtant, toi, oui toi, comme tous les __sauvages__, tu te laisses influencer par les apparences extérieures d'une personne
* Martin Luther, comme tous les __théologiens catholiques__ avant lui, pensait la même chose : le châtiment terrestre infligé par l'Eglise et si nécessaire par l'état, est en fait l'oeuvre de la grâce de Dieu pour en sauver certains de l'enfer
* parce ce que c'est moi qui l'ai créée cette liste et le __comme__, il faut l'entendre comme un adverbe de comparaison et non comme un adverbe de temps, ce ne serait pas dans l'esprit, voilà pourquoi. La règle paraissait pourtant claire, voir la remarque à la fin.
* N'oublions pas que dans notre misère quotidienne, la liste Wiki est comme tous les __softwares open source__ : sujette à des modifications parfois indésirables...
- Ecoute, il se râpe du fer par l'étendue -%%%
ListeDeChosesRepugnantesQuiCommencentParLaSeiziemeLettre
!!%%Center(__Liste de choses répugnantes qui commencent par la seizième lettre__)%%
* Paracétamol
* Parachutes qui ne s'ouvrent pas (Chose une seule fois répugnante) (Surtout à la fin ... sploutch!)
* Parachutes dorés
* Parachutistes ("C'est pas exprès qu't'étais fasci-iste...")-- µµOh ! Le cliché à 30 centimes d'euros ! Comme si on ne pouvait pas avoir la passion du parachutisme sans être facho...µµ
* Parade militaire [http://www.houseofice.com/history/wehrmarchsmall.jpg]
* Parasites
* Pari de Pascal
* Parisiens (enfin pas tous...)
* Partis Politiques
%%Image(http://rockefeller.univ-lyon1.fr/Anatomie-Lyon-Nord/m_endosc/ENDOSCOPIE%20PAR%20VOIE%20HAUTE_fichiers/image018.jpg,150,150)%%
* Pigeons de Paris
* Pitié
* Pornographie ''Rajouté par Christine Boutin µet par Ségolaineµ''
* Postulat du Paradis Perdu
* Prostitution ''Rajouté par Christine Boutin µet par Ségolaineµ''
Ne conviennent pas (choses admirables commençant par la même)
* Partie de jambes en l'air
* Partouse
%%Blue(''µ(d'après une idée de Roland Topor)%%%(Pardon Pour cette Pauvre liste Peu Poétique)µ'')%%
ListeDeCadeauxDeNoel
/*Par pitié ne laisser pas le sapin allumé toute la nuit
** µPourquoi cette étrange majuscule ? -- parce que j'ai envie !µ
* Un joli massage prodigué par la mère Noël
* Un ventre rond et blanc - moi je préfère un ventre plat et doré - µles ventres plats sont des aberrations inventés par le lobby des régimes - et puis un ventre plat en pleine fête de Noël, c'est un peu zarbi, non ?- par contre pour le doré, c'est Ok pour moi !µ
* Une nuit à Paris
** Ou une nuit avec [Paris|ListeDeToponymesCoruscants]
* Une nuit avec Paris Hilton (mais juste une, hein !)
*un irrite-muqueuses offert par une gueuse
%%Center(µµTu parles d'un cadeau !µµ)%%
ListeDeBoutons
/*Par pitié de mettez pas de liens sur des gros boutons, merci !
* les petits [boutons|http://www.paroles.net/texte/21560] de nacre [http://www.jeudemailles.com/images/b18bp.jpg]
* le célèbre bouton du Désordre, utilisé par les Professeurs Hank Hartmut et Robert Sanders µµ(merci, Phil de J)µµ
* "dessine moi un bouton" par Henri Cueco (Seuil, ISBN 2020399423)
ListedAccessoiresdeJeux
/* par PITIE ne mettez pas de liens vers de GROS accessoires. merci
** µµpar contre pour jouer au canard, deuc coins suffirontµµ
ListeDelivressurlacreativite
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
Liste proposée par frederiqueauteure du blog Wild Writing / Délire d'écrire.
HitoireDeListesLeRetour
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
Il fit rapidement le point de la situation : l'un des palmiers auquel le hamac était attaché s'était brisé net et le hamac par un mouvement de pendule bien imaginable état venu heurter l'autre arbre ; ce qu'il contenait avait tout naturellemnt été entrainé dans le même mouvement et il s'était durement cogné les cervicales contre le tronc.
Sans écouter les larmes d'Antoinette couler au creux du doux vallon de ses seins mous et parfumés, il prit les commandes de son Falcon personnel, et décolla simultanément.
Le Falcon filait droit sur la tour Montparnasse. Pas de bétises, nous sommes le 11 novembre 2002. Jack amorça un élégant virage et posa l'aréoplane sur la piste - récemment emménagée - du Père Lachaise. Aprés s'être brièvement recueilli sur la tombe d'Abélard et Héloïse et sur celle de Pierre Desproges, il se dirigea sans coup férir vers le quartier général du Prof. Blorer.
culotte sur les mêmes bancs du lycée Lakanal, à Ourcq) µµ%%Red(''ne serait-ce point une contrepéterie ? - non- c'est à cause du canal de l'Ourcq'')%%µµ . Je t'ai appelé parce qu'il faut que tu quittes Antoinette.
Quoi? je ne puis en croire mes yeux - s'écria Jack au comble d'une émotion profonde et sans [ambage|http://www.chez.com/usmb/page5.html] µµ%%Red(''heu... tu veux dire sans jambage ? - non'')%%µµ . Alain ? par ma mère et sur mes enfants, Alain c'est mon frère ! et Antoinette ! De ma vie je n'ai connu de femme plus fidèle (et plus charnelle se dit-il in petto) . Je ne peux croire ce que tu me dis, ami .
Calme toi, ami. Blorer le tapota. Il faut que tu saches que Alain Rey et Antoinette préparent un livre ensemble : "Le Grand Dictionnaire des Roberts". Et tout ça parce que Antoinette a été envoûtée par le Mage Cambiz, un sorcier du genre vaudou, pas un rigolo, un vrai de vrai !
Il faut trouver ce Mage Cambiz et le contraindre par tous les moyens à lever la malédiction. L'homme est fourbe et retors, ce ne sera pas facile, mais je sais où il est. Il a envouté Antoinette et Alain avec la ListeDeHerve.
[http://www.tohtori.fi/itsehoitoapteekki/para-sup.jpg]
Une faute de frappe ça ne pardonne pas dans un code. Jack ne savait pas où pouvait bien se trouver son ennemi intime et Blorer avait disparu ....
Soudain, venant de nulle part, un air bien connu se fit entendre : « La-victoa-ran-chan-tant... nous-zooooouuuuuu-vreula-ba-rièèèèè-reeeeuuuu !!!.... » 
Le gendarme eût un sourire condescendant."Vous voulez parler de l'Amiral sans doute ? Un bon à rien, la honte de la famille. Nous, on l'appelle Coule-tout-seul"
"Je n'ai pas le coeur à rire. Mon bédane vient de m'apprendre µ%%Red(ah bon ? et quand ça ?)%%µ qu'Antoinette et son chinchard étaient séquestrés par le prélat Préli dans le confessional de l'abbaye d'Aulps !"
%%Red(µµmais comment mainenant i sait que c'est à Aulps ?!!! - Parce qu'il a lu SuiteDeHistoireDeListesTrois - µµ)%%
"L'abbaye d'Aulps, professeur ! Mon collègue [fantassin|http://10la.1usss.free.fr/fantassin/], le brigadier Blorer, vient précisément de partir pour la gare d'Aulps rejoindre son frère pour une histoire de disparu. Montez donc sur ma croupe, Monsieur Jack. Je m'y rendais. Allons-y de [concert| http://perso.wanadoo.fr/ferrezp/lara_fabian.htm]."
"Non, je vais prendre mon hippocampe volant. Nous pourrons ainsi encercler l'abbaye. Vous, par la terre, moi, par les airs. Dommage que l'Amiral ne puisse attaquer par la mer. Rendez-vous à [Aulps|http://www.valleedaulps.com/]. Au galop, Tornado! " (l'hippocampe volant s'appelait en effet [Tornado|http://www.tornado.fr/])...
%%Red(µµbon ok, j'ai peut-être pas tout suivi, mais COMMENT ils savent qu'il faut aller à Aulps ? - parcequ'ils ont lu le début de l'histoire.µµ)%%
Mais heureusement, une onde bienfaisante parvint à vaincre ces pensées belliqueuses...L'oracle ne l'avait-il point prédit .." ''Les héros ne feront rien, néamoins ils seront souvent émus et penseront à de belles choses.''"
Il pensa aux ronds flancs d'Antoinette, envoutée par le mage Cambiz, il pensa au premier ministre de la France, kidnappé et enfermé à Aulps, il pensa au prélat Préli, éducateur de jeunes nonnes, il pensa à Alain Rey et ses yeux se mouillèrent, il pensa à Simone Abeille et ses tendons se tendirent, il pensa à Blorer, volatilisé. Il pensa à Peggy, la cow-girl qui lui avait appris à monter.
Il se rappelait toutes ces années... ses souliers couverts de poussière... µµ%%Red(- euh... moi je croyais que c'était les murs... - )%%µµ tous ces chemins qu'il avait parcourus, seul, harassé, mourant parfois de faim... Toujours en quête de quelque chose... Mais QUOI ? (L'inaccessible étoiiiiiiiiiiiiiiiiiiile !)
Et le jour pour lui était comme la nuit... Il rêvait d'une ville étrangère, une ville de filles et de jeux. Il voulait vivre d'une autre manière dans un autre milieu. Il révait de revivre ses amours illicites avec la Duchesse d'Orléans, dans le [pavillon|http://www.salesien.com/curieux/ermitage1.htm] de l'Ermitage.µµ Le pavillon de l'ermitage est tout ce qui reste du château de Bagnolet (Paris 20e) ; Il fut édifié en 1734 par Serin pour la duchesse d'Orléans. Célèbre par les amours et les complots du baron de Batz ,qui tenta de délivrer Louis XVI , ce bâtiment est rarement ouvert au public.µµ
Tiens, le gendarme Blorer n'est pas encore arrivé... %%Red(µµlol c'est pas Blorer le gendarme c'est Cééééééééédrooooooc !!!!..''Bon, ben après un vol en hippocampe, jack a peut-être l'esprit embrouillé, quoi !''µµ)%%aura été retardé par quelque fourbe forfaiture...Profitons-en pour tendre un piège machiavélique au mage Cambiz...attirons-le sournoisement dans un chat mirc fallacieux..AH ! Ah! Ah!
Contrarié, le prélat se retira dans la bibliothèque de l'abbaye et armé de sa longue vue, observa les préparatifs belliqueux de ses ennemis. Qui à cheval, qui sur un hippocampe volant, qui en ballon, ils arrivaient, animés d'ardeurs guerrières. Il se mit à échafauder des plans de riposte.[http://palladio.free.fr/aulppreli04.jpg]%%Center(Le prélat Préli en robe d'airain inspecte les défenses de l'abbaye d'Aulps)%%
Paradoxalement, le prélat Préli prit peur: Palsambleu %%Green((2))%% ! Prenons nos pécautions, et prions en priorité ! Le prude prélat pria prudemment. Puis, pratique, il ferma tous les portiques. Le pragmatique prélat se prépara à praliner sans préalable, avec ses praticiens préalpins. Il précipita le préchauffage et le précombustion. Sans préambule ni préavis, il prit la prarole: "précaires précambriens !! , prédateurs précuits !!". Présomptueux et pressé, il préleva des préservatifs, au cas où, aprés le prélude, sa protubérance priapique se prolongerait sans préliminaire.
...Et s'enferma derechef dans la bibliothèque, de plus en plus contrarié. Il fallait CONTRE-ATTAQUER! Il révisa in petto ses batailles napoléoniennes. Pendant qu'il réfléchissait, le moine Cédroc - un ancien amiral renié par les siens et qui avait embrassé les ordres - vint l'avertir que les prisonnières se livraient à des trafics.
µ%%Green((1) ''"ce verbe germanique, qui a pour cousin prospère l'anglais beat (...) manifeste le dynamisme parfois brutal des Francs, puis des Français. Frapper, pousser,refouler sont venus le remplacer, tandis qu'il donnait naissance aux bouts, aux boutons et aux boutoirs, aux boutures et aux boutades, à emboutir comme à emboutir, et même aux rebouteux, car tout cela pousse ou sert à pousser." Alain Rey, la vie des mots '')%%µ
µ%%Green((2) ''Etym. Par le sang de Dieu - Alain Rey'')%%µ
HistoireDeListesLeRetourTrois
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le (ouaibmestre), PAS DE GROSSES IMAGES - MERCI
µRésumé succint. Le prélat Préli a enlevé [Antoinette|http://www.echolalie.com/feuille.htm] de Gabolde d'Audan et le [Premier Ministre de la France|http://www.premier-ministre.gouv.fr/], qui sont retenus dans l'abbaye d'Aulps, assiégée par la Royale, MAM, le Charles De Gaulle et la police montée canadienne. Le rôle du mage Cambiz est ambigu(1). Jack et ses amis s'apprêtent à passer à l'attaque. Des pacifistes interviennent.%%Red((µµils sont émusµµ))%%. L'Amour sera-t-il, encore une fois - au rendez-vous ?µ
Dites-moi "''oui''". Le prélat Préli pourrait bénit notre union. Je suis prêt à tout pardonner.
Justement, le prélat, après avoir par précaution procédé à un préchi-précha paroxystique à l'aide de son praxinoscope, profitait, prostré à proximité, d'un proupillon post-prandial dû à la prise d'une profusion de profiteroles..
"Mais nous possédons l'ARME SUPRÊME, déclara avec exaltation l'homme de Dieu, nous allons invoquer Yog-Sothoth, et ôtant sa main du livre sur lequel elle reposait depuis le début de la réunion, il fit apparaître le titre, abominable entre tous, du formidable [NECRONOMICON|http://www.locksley.com/cthulhu/necro.htm]."
L'assistance publique de cette maléfique invitation frémit d'une horreur mal contenue. [Les moinillons se roulaient par terre|http://www.audinex.es/~dariogon/vin10-2.htm], la bave aux lêvres, tandis que les jeunes nonnes obscènement se dégrafaient.
Insensible à cette prière d'amour le prélat fou commença à invoquer les Grands Anciens : "Par Chtulhu... ". Mais le sage Blorer - fort de sa toute nouvelle religion - entreprit Mgr sous le prétexte de la querelle des Universaux et de leur impact sur la foi sans contrition qui siérait à tout bon musulman. Il se mit à l'assommer d'une lecture nécronomicone du Qoran, selon laquelle les traces du Qalam ne seraient qu'une inversion de la Bible - c'est-à-dire rien d'autre qu'une bible lue à l'endroit. Il croyait convaincre le procrastinant Préli - qui repoussait à deux mains son désir de prendre Antoinette - en arguant que seuls les gens d'en haut possédaient cette clé universelle.
Terrassé par un regard ô combien augustinien du prélat, le nouveau converti se mit à prier afin de cesser d'osciller entre les libido sciendi, dominandi et concupiscendi pour échapper à sa crise de foi qu'aucun suppôt, fût-il magique, ne saurait résoudre.
"Mais, si vous êtes, Antoinette, encartée, je ne peux vous épouser! Anticonstitutionnellement parlant, ce serait peu raisonnable. Plus question de phrases sobres, ni de %%Red(Révolution d'Octobre)%% - Détartrez-vous!! Décartez-vous veux-je dire !!"
"Ah, Ah - Ah Ah Ah !! - Antoinette releva sa jupe rouge à poix blancs et se mit à chanter, tout en roulant un cigare sur sa cuisse bronzée, humidifiée par une fine pellicule de sauvage sueur - L'amour est enfant de Bohême, il n'a jamais, jamais connu de loi, si tu ne m'aimes pas, je t'aime, si je t'aime, prends garde à toi!"
C'est alors que contre toute attente, le mage fit apparaître de dessous un drap, l'ouvrage que tout le monde recherchait et qui, à n'en pas douter, allait faire franchir une étape décisive à cette histoire. Eh oui ! ce n'était autre que la biographie de...
[http://rael-elohim.pegasus-paradise.com]
en bas apparaissait lisiblement la signature de l'auteur : µ__Jean-Pier-re Raf-fa-rin__µ
"Oh ! enlevé par des extraterrestres ?!!!" s'exclamèrent d'une seule voix tous les participants stupéfaits ?
"Comment étaient-ils ?" reprit en coeur les participants médusés.
C'était Sphinx, le beau canadien qui s'avança devant l'assemblée, tout ému, couvé par le regard de braise de Simone...
mmmhhh!!! oui c'était vrai, il embrassa par la suite passionnément Simone pour confirmer ses émotions et les faits.
et partir en vrombissant vers la Maison Bleue pout y pécher de nouvelles instructions.
/*Bien sympa ton site sur Rael et les Elohim accessible uniquement avec cet adresse http://rael-elohim.pegasus-paradise.com toujours Rael en sujet
HistoireDeListesLeRetourQuatre
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le (ouaibmestre), PAS DE GROSSES IMAGES - MERCI
µRésumé succint. Le prélat Préli a enlevé [Antoinette|http://www.echolalie.com/feuille.htm] de Gabolde d'Audan et le [Premier Ministre de la France|http://www.premier-ministre.gouv.fr/], qui sont retenus dans l'abbaye d'Aulps, assiégée par la Royale, MAM, le Charles De Gaulle et la police montée canadienne. Le rôle du mage Cambiz est ambigu(1). Jack et ses amis s'apprétent à passer à l'attaque. Des pacifistes interviennent.%%Red((µµils sont émusµµ))%%. L'Amour sera-t-il, encore une fois - au rendez-vous ?µ %%Red(µµfacile..c'est le résumé du chapitre II..pfff..µµ)%%
## __professeur Blorer__%%Blue((µµmais non, le Professeur Blorer a atteint le Nirvâna, il est devenu immatériel (tout juste qq traces de gin ds du rien), c'est un avatar que vous croisez ds cette aventure, mais vous ne pouviez pas savoirµµ))%% %%Red((µµ mais non ! Il est revenu de sa méditation au chapitre précédant et s'est mis à lire le Qoran - rematérialisé par les prodiges célestes du Mage - avec les lunettes du Necronomicon après avoir heurté un pilier de l'abbaye où le pieu prélat Préli s'épile en pensant plaire à Antoinette qui paluche le Premier ministre, et il ne boit plus que de la toupe d'Aulps µµ))%% %%Green((µµmais non, vous avez rien compris du tout, les sortilèges, même les plus puissants, ne peuvent rien sur l'immatériel, c'est un CLONE, un zombie, que vous voyez apparaître de temps à autresµµ))%%
## __Jean-Pierre Raffarin__ - PM (premier ministre) de la France, présente de grandes similitudes de caractère avec le gendarme Cédroc cité plus haut - Un peu trop tendance à se laisser balloter par les flots sans se soucier des risques insensés pris par Les Bons pour protéger sa vie.
## __M.A.M.__ - ministresse de la Défense d'icelui. caractère entier, ne réfléchit pas suffisamment avant de parler ce qui lui éviterait d'être l'objet de grosses esclaffades de la part de ses troupes
Attiré par la scène (télépathie !), le Pr Blorer, rematérialisé, arriva du [Nirvana|http://www.nirvana.co.il/] avec un pote. Il se souvenait de sa Harley de mai 68.
µµNote de l'ectoplasme:%%%Blorer ne "fout" (quel langage ...!) rien du tout, un être immatériel, même gorgé de gin, ne peut RIEN faire du tout. Y'en a qui sont lents de la comprenette .... Tout au plus son aura métaphysique peut-elle parfois émaner des ombres fugitives que des âmes simples prennent pour une réalité.µµ
Du fond du fondement du bas de l'abbaye d'en bas monta soudain un grondement puissant et déchirant. Ce n'était pas le Premier Ministre manipulé par Antoinette, ni MAM - baillonnée depuis peu - , mais un cri étrange, venu d'ailleurs, la manifestation terrestre de l'abomination des abominations infernales, Cthulhu, réveillé par le bruit des hélices du Charles De Gaulle qui remuaient en vain l'eau rance de la Dranse. "Qu'est ce que c'est que ce bins?" hurla la créature, pendant que les remugles de son odeur cadavérique pestilaient l'atmosphère, qui verdatrissait de manière écoeurante.
"Sans la musique, la vie serait une erreur". Angèle Bielle, envoutée par les maléfiques émanations de la démoniaque créature, posa sa main sur l'épaule de Jack et le sussura languidement: "Besame, besame mucho, como si fuera esta la noche ..."
%%Blue(µµc'est qui cette Angèle Bielle ? - Angèle Bielle est le pseudo de Simone Abielle quand elle fait du Minitel - Ah ! Simone A-BEIL-LE !!! parce que ça se passait au minitel toute cette histoire ? ça va douiller !!! qui c'est qui paie ? - c'est la [Prod|http://www.echolalie.com/statuts.htm]µµ)%%
Profitant de cette diversion à laquelle assistaient, les yeux fixes et la bouche béante, comme à une premère du grand Rex, nos héros et vos anti-héros, l'immonde Cthulhu s'empara d'Antoinette.
[http://www.bdparadisio.com/Images/Corben/corben5.jpg]
[http://www.bdparadisio.com/Images/Corben/corben1.jpg]
HistoireDeListesLeRetourDeux
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
Pendant que ces évènements se déroulaient en altitude, Jack se rendait bien compte que les défenses érigées par le prélat Préli étaient formidables. Une idée germa dans son puissant cerveau. "Pacôme !"
"Un message de Roland Moreno !!!" "Munissez-vous d'eau de Lourdes et arrosez le QG du Prélat. Vous pourrez ainsi court-circuiter ses cartes à puce, et paralyser son système de défense." conseillait le sémillant inventeur.
qu'une chute de la pression sur le plan décrit par la singularité de
%%Red(µµQuoi ?!!! il est là Alain Rey ? Mais comment et quand il est arrivé ?!! On nous cache tout !!µµ)%% Alain Rey - qui lisait d'anciens palimpsestes dans la bibliothèque de l'abbaye - était en effet venu se joindre au commando, car il parlait couramment le latin, le bas latin, le haut latin, le sanscrit et le grec ancien et moderne. Il pensait que ses compétences pourraient être utiles.
Les eaux de la Dranse se mirent tout à coup à tumultuer. [http://www.kayakmagazine.com/nmtravels/2001/September/FranceThononFrenchPutIn.jpg]Un porte-avions arrivait comme un coup de tonnerre dans un ciel de serins. A l'avant de la proéminente proue, propulsée au [nucléaire|http://sortirdunucleaire.org/], MAM s'empara d'un hygiaphone et cria : "ici l'armée française de la France ! halte au feu. Nous savons que le premier ministre est ici ! rendez-vous ! " Le Charles De Gaulle %%Red(µµMais je croyais qu'il avait coulé après avoir heurté un iceberg dans la Mer Noire ? - pfff - Ils l'ont renfloué à l'aide de cerfs-volants géants µµ)%% tangua, vrombit, mugit, perdit quelques hélices, et s'immobilisa au pied de l'abbaye. Il commença doucement à fondre sous l'effet du métomol. Simone Abeille, vétue d'un simple paletôt en cochenille mercerisée, se figea, saisie par le vacarme. "Attachez-moi !!, cria MAM, ou je les dégomme tous". La tension était à son comble.%%Smiley(confused)%% Blorer se tourna vers la Mecque. Le moinillon Cédroc faisait cuire des tagliatelles aux olives, avec de la tapenade, de la crême fraiche et du parmesan, tout en fredonnant "Alexandra, Alexandrie".%%Smiley(petard)%% Un à un, les F1 ,Hornet, Mirages, Rafales quittaient le pont du CDG et s'apprêtaient à affronter les cerfs-volant(s?) de combat. Atterré, le mage Cambiz avait atterri au Père-Lachaise, avant de se rendre dans la cave secrète du café des Trois'Arts pour y procéder à de nouvelles et maléfiques incantations.%%Smiley(crazy1)%%
Antoinette fut tout de suite émue par l'aspect sauvage de ce bel homme rubicond. "Puis-je vous franchir ?" minauda-t-elle , avant d'enjamber d'une cuisse galbée et gainée de nylon [noir|http://echolalie.free.fr/wiki/index.php?ListeNoire] une caisse de chinchards éventrée par un éclat de métomol. "Allez, ha, Jack, ta veste !!" s'écria GB. La veste de celui-ci avait en effet pris feu, alors qu'il envoyait son message codé : "Delenda est prélat Préli" .%%% "Regardez, du renfort !" MAM se rajusta. La flotte aéroportée canadienne venait de débarquer. Un parachutiste atterrit devant MAM. "Commandant Patrick M. , nom de code Sphinx_sleeping. Un peu fatigué, car j'ai bricolé avec mon chum. Les tuniques rouges sont à votre service". %%Red(µµMoi ce que j'aime dans ce roman wikieste, c'est la réactivité des ôteursµµ)%% %%Red(µµ''Moi ce que je constate, c'est que les ôteurs ils aiment bien jouer à la guerre''µµ)%% %%Blue(µµSauf Blorer qui préfère la métaphysiqueµµ)%% %%Red(µµBon est-ce que je pourrais ajouter ma suite SVP ?µµ)%%
"Ah Mademoiselle, je vous supplie de pardonner ce méli-mélo !" Il mit un genou à terre. " La flotte aéroportée canadienne est à votre disposition, pour votre bon plaisir !"
%%%"Cette guerre m'excite comme une puce" sautilla MAM en battant des mains %%Red(µµQu'est-ce qu'on attend pour la ligoter puisqu'il paraît qu'elle aime ça ?µµ)%%. Elle fit déployer une batterie de mangonneaux, servis par une compagnie de listoboles.
Alain Rey prit la parole. Un silence assourdissant détonna sur le champ de bataille pendant que le docte savant expliquait : "Le mangonneau est une énorme machine (XIIème-XIVème siècle) qui exige la présence de 12 [listoboles|ListeDeSuffixes] et d'un chef de manœuvre, ou ouaibmestre, qui en dirige la construction et le fonctionnement. Le levier est abaissé à l'aide d'un treuil actionné par deux roues, six personnes sont nécessaires car le contrepoids pèse plusieurs tonnes. Quand le levier est abaissé on accroche la poche de la fronde et on y dispose un gros boulet ou même plusieurs pierres. Le chef de manœuvre donne le signal, le levier est libéré et un groupe de tireurs se suspendent aux cordes et accélèrent le mouvement ascendant de la fronde.
%%%La mise au point du tir est assez longue et on doit souvent procéder à de nombreux essais ; plusieurs sont parfois nécessaires. Cette machine ne peut lancer un projectile pesant jusqu'à 100Kg, un gros moine tibétain par exemple, que toutes les deux heures environ, mais dès que le pointage est terminé les dégâts occasionnés aux fortifications sont considérables.La distance de tir pouvait atteindre jusqu'à 150 mètres." %%%Blorer s'enfuit en se bouchant les oreilles. C'en était trop pour lui. Il alla se réfugier dans un [site|http://glecornu.perso.club.fr/machines.htm] plein de machines de guerre pour y bouter le feu.
Par souci humanitaire, les mangonneaux furent chargés de poulets rôtis et accompagnés de sommations préliminaires. Au signal du chef de manœuvre, une pluie de volatiles manchots s'abattit sur l'abbaye.
%%Green((1)µ''Étymol. obsc. H. Polge ds Romania t. 93, 1972, pp. 563-567 suppose un étymon du type *serpe volante « serpent volant » (serps = serpens [serpent*] est attesté en lat. chrét. ds BLAISE) croisé par attraction paron. avec cerf-volant'' [TLF|http://atilf.inalf.fr/tlfv3.htm]µ)%%
HistoireDeListesLeRetourCinq
/* PAR PITIE, dit le PRELAT PRELI, PAS DE GROSSES IMAGES - MERCI
/* PAR PITIE, dit le (ouaibmestre), PAS DE GROSSES IMAGES - MERCI
µRésumé succint. Le prélat Préli a enlevé [Antoinette|http://www.echolalie.com/feuille.htm] de Gabolde d'Audan et le [Premier Ministre de la France|http://www.premier-ministre.gouv.fr/], qui sont retenus dans l'abbaye d'Aulps, assiégée par la Royale, MAM, le Charles De Gaulle et la police montée canadienne, et Cthulhu. Le rôle du mage Cambiz est ambigu. [Antoinette|http://www.echolalie.com/feuille.htm] veille au grain, et Simone Abeille pleure en écoutant Jacques Brel. Le lama Blorer s'est transformé en ectoplasme. L'Amour sera-t-il, encore une fois - au rendez-vous ?µ
Bercé par la voix mélodieuse de MAM le PM s'épancha : "J' ai encore rêvé d'elle, toute en douceur, juste pour mon coeur; Je l'ai révée si fort que les draps s'en souviennent. Je dormais dans son corps bercé par ses "je t aime". Si je pouvais me réveiller à ses côtés... Donnez moi l'espoir, une nuit pour elle et moi. Elle n'est pas vraiment belle, elle est faite pour moi. Toute en douceur juste pour mon coeur. Enfin je vais me réveiller. Bien sur je vais la retrouver. Laissez-moi, je vois, une vie, juste elle et moi. Et un [nouveau porte-avion|http://echolalie.free.fr/wiki/index.php?ListeDeNomsaDonnerAuNouveauPorteAvions]"
Contrarié par tous ce bins, Jack empoigna sauvagement Antoinette "I want you, I want you so bad, I want youhouhouh, I want you so bad, It's driving me mad !!!"
"Dites au curé, dites au prélat, qu'ailleurs ils aillent se faire pendre, et mon âme n'est plus à prendre. Je n'étais qu'un fou mais par amour, elle a fait de moi un fou, un fou d'amuur. Le jour se lêve, la nuit pâlit, la bête doit mourir ce matin, je veux m'endormir, pour toujours, prés d'elle." Jack était fatigué.
"Moi qui brûlais ma vie aux quatre coins des nuits. Moi qui ne croyais rien qu'à ces petits matins, aujourdh'ui je crois en mon destin. Regarde, regarde, Antoinette, ce signe venu du ciel et qui folliculle notre amour" - Un parchemin pendulait au plafond, couvert de cataglyphes étranges.
L'imagination n'est pas partie ![http://cover09.cduniverse.com/MuzeVideoArt/33/185833.jpg]
µOn dirait que c'est fini? - Euh... oui... qu'est ce que vous n'avez pas compris ? - Je ne sais pas si c'est fini, mais en tout cas je n'ai jamais rien lu d'aussi dégoûlinant de mièvrerie. Même "Nous Deux" n'aurait pas osé - Pari gagné !!! Niqué "Nous deux" !! C'est la gloiiiiiiiiireeeee !!! - mmm . Et si on lançait 'Doux noeud' le magazine d'Echolalie ? - µ
ListedElephants
! /*Par pitié pas de gros n'éléphants ! Merci !
* Diplôme de l'ordre du million d'éléphants et du parasol blanc
* Éléphant à la mode hippie dans The Party de Blake Edwards [http://bp3.blogger.com/_yKaSJWAXHrY/SCbzMiMZGJI/AAAAAAAABbI/HavV0GClJ_c/s320/recto.jpg]
* Éléphant blanc apparu en rêve à la mère du Bouddha la veille de son accouchement et lui annonçant qu'il serait sa dernière incarnation humaine
* Éléphant Célébès peint par Max Ernst
* Éléphant conduit par Tarzan sur une broderie traditionnelle panaméenne [http://tbn0.google.com/images?q=tbn:1UaO6uuqvfsM_M:http://www.fortunecity.com/marina/longmark/1025/tarzan.jpg]
* [Éléphant de la Bastille| http://www.ac-bordeaux.fr/Etablissement/JMonnet/histgeo/paris2000/gavroche.html], où se cache Gavroche
%%Image(http://www.ac-bordeaux.fr/Etablissement/JMonnet/histgeo/paris2000/gavroce.jpg,214,129)%%
* Éléphant dessiné par Benjamin Rabier
* Éléphant dessiné par Franquin (dans Tembo Tabou notamment)[http://www.bdcentral.com/Spirou/albums/spirou24.jpg]
* Éléphant dessiné par Gustave Doré
* Éléphant dessiné par Mordillo
* Éléphant dessiné par Reiser (la vie au grand air)
* Les éléphants du [PS|http://www.parti-socialiste.fr/]
* Éléphant mangé par un serpent dans Le Petit Prince [http://bp2.blogger.com/_J0NYq6zxbPw/R8w1CowKYsI/AAAAAAAABDo/Y-R9vtpvDf0/S220/1).jpg]
* Éléphant du %%Link(parc,http://tourisme.voila.fr/villes/lyon/fra/sit/ville/ptetedor/zb08.htm)%% de la Tête d'Or
* Éléphant spatial de Dali [http://www.daliparis.com/image/symboles/elephant.jpg]
* Éléphant, symbole du parti républicain aux États-Unis[http://www.horaz.com/horazyclopedia/Photos/Republicains/02_MID/Elephant_05.jpg]
* Éléphant[pour le calcul|http://www.parcours.qc.ca/imaths/add10b.html]
* Éléphants de la place Denfert-Rochereau à Paris µµ ils sont où ? Y a qu'un lion !µµ[http://www.paris.cx/streets/denfert_rochereau/mvc-005f.jpg]
* __J__ouons avec les éléphants. Je m'appelle V., et chez mon cousin V. (aussi, mais pas pareil ensuite) y'a des animaux sauvages :
Selon le [Dictionnaire (en ligne) du Concombre Masqué|http://www.leconcombre.com/dictionnaire/dico/concdico01.html#elephant] de Mandryka, l'éléphant partage volontiers son pantalon.
* Encourageons les éléphants en surpoids à faire du sport le Dimanche [http://www.freeclipartnow.com/d/6190-1/elephant-on-a-bike.jpg]
* [Nellie|http://www.deezer.com/listen-2675929] des Toy Dolls (repris en concert par Loic Lantoine pour le plaisir de faire oooooooOOOOOO…, comme dans Faut pas dire du mal de Johnny)
* [Voter Élephant Blanc, c'est pas bête ! |http://iquebec.ifrance.com/partielephantblancdemontreal/]
%%Blue(µµCréé par Damien P.µµ)%%
Au restaurant "[L'Eléphant Rouge|http://www.elephantrouge.com/intro.htm]", 93, rue Manin 75019 PARIS, il y a des éléphants partout.
John Lennon a été accompagné par un groupe , qui a fait au moins un disque, que j'ai eu, qui s'appelait: Elephant's Memory[http://www.queermusicheritage.com/JUN2005/Elephants%20Memory%20LP.jpg]
ListeDeMalentendusConjugaux
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListeDeMars
/* par PITIE ne mettez pas de liens vers de GROS martiens. merci
* 5 mars 1616 !: La théorie copernicienne énonçant que la Terre tourne autour du Soleil est déclarée fausse et erronée par l'Eglise Catholique.
* 13 mars 1781 : William Herschel découvre la planète Uranus au moyen d'un télescope de 6 pouces construit par lui-même
__µµ%%Center (Recommandé par Marjorie.)%% µµ__
** Et j'Onn j'Onzz :%%%µµLe véritable nom du [Martian Manhunter|http://gotomars.free.fr/jon_jonz.html] est j'Onn j'Onzz (prononcé comme Jones), il est le dernier de la race des martiens verts. Un jour, j'Onzz a été déplacé par télépathie sur la Terre grace à un télétransporteur créé par professeur Erdel, qui essayait de créer un dispositif de communications entre les deux mondes. Malade du cœur, Erdel est mort du choc et j'Onzz s'est retrouvé échoué sur notre planète.µµ[http://farm2.static.flickr.com/1138/638191551_c3af2fe2c2.jpg]
** Et celui qui est dans le frigo ! µµ(écrit par Simon Gallubert sous un nom d'emprunt)µµ
* Champ de Mars [http://www.harris-interiors.co.uk/images/Eiffel%20Tower%20from%20Parc%20du%20Champ%20de%20Mars.jpg]
* Giboulées de mars µµ "Tandis qu'à leurs œuvres perverses / Les hommes courent haletants,/Mars, qui rit malgré les averses, / Prépare en secret le printemps"(Théophile Gautier)µµ
** Le lièvre de Mars, BD paranoïaque
* Un mars et ça repart (confiserie gluante et calante)
* un Mars et la liste repart ! (c'est le cas de le dire :) ) ... Houba !
µµCréé par Kindofblue, reconstitué par Damien P - merci DPµµ, µµet remélangé par A. :-) -- et sponsorisé par µµ
ListeDeTookDrugsSawGodBfd
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
(A pris des drogues, a vu Dieu, tu parles d'une affaire...)
ListeDeSinges
/*Par pitié...
* La guenon sculptée par Picasso dont la tête est formée de deux autos miniatures [http://www.artnet.com/Magazine/news/artmarketwatch/Images/artmarketwatch11-5-8s.jpg]
* Les millions de singes - par William Sheller
**µµNous sommes des millions de singes%%%Sur un peu de terre entourée d'eau,%%%Parmis des millions d'étoiles%%%Qui dansent dans le ciel comme un cerceau.%%%Nous sommes des millions de singes%%%Assemblés dans la lueur d'un flambeau.µµ
** Michel Pebereau (idem de BNPParibas)
** et bien sûr... Madame Laurence Parisot (idems des items précédents)
* Monkey see, monkey do - par Michael Franks
* Si les autres parties du monde ont des singes, l'Europe a des Français. Cela se compense. (Schopenauer)
* Si on suspend à une corde passée sur une poulie, un poids de 10 Kg, exactement équilibré par un singe agrippé à l'autre extrémité, qu'arrivera-t-il au poids si le singe essaie de grimper le long de la corde ? (On suppose que la corde et la poulie ont une masse négligeable et ne sont soumises à aucun frottement.)''
**µBorel, 1913µµ... Concevons qu'on ait dressé un million de singes à frapper au hasard sur les touches d'une machine à écrire et que, sous la surveillance de contremaîtres illettrés, ces singes dactylographes travaillent avec ardeur dix heures par jour avec un million de machines à écrire de types variés. Les contremaîtres illettrés rassembleraient les feuilles noircies et les relieraient en volumes. Et au bout d'un an, ces volumes se trouveraient renfermer la copie exacte des livres de toute nature et de toutes langues conservés dans les plus riches bibliothèques du monde. Telle est la probabilité pour qu'il se produise pendant un instant très court, dans un espace de quelque étendue, un écart notable de ce que la mécanique statistique considère comme la phénomène le plus probable...µµÉmile Borel, ``Mécanique Statistique et Irréversibilité,'' J. Phys. 5e série, vol. 3, 1913, pp.189-196.µ
** µSinge, s. m. Ouvrier typographe. Ce mot, qui n'est plus guère usité aujourd'hui et qui a été remplacé par l'appellation de typo, vient des mouvements que fait le typographe en travaillant, mouvements comparables à ceux du singe.µ
* the Monkey Puzzle, le problème du singe posé par Lewis Carroll :
* Un livre est un miroir. Si un singe s'y regarde, ce n'est pas l'image d'un sage qui apparaît (Lichtenberg)
* un singe vous [parle|http://www.reseaulibre.net/rage/lasinge.html] (mais je vous préviens, c'est loin d'être désopilant)
µµSingé par Damien P - reclassé, nettoyé et restaurlienmorté le 11/11/07 -- et rebelotte le 24/8/08µµ
ListeDeSanctionsDisciplinaires
/*Par pitié ne mettez pas des liens vers des grosses sanctions. thank you very much.
** Quelqu'un pourrait traduire ? Je ne parle pas anglais.
* l'exclusion temporaire de fonctions pour une durée de trois mois à deux ans, et pendant ce temps là il y du classement et des archives à faire... et puis il y a l'économat aussi... non pas l'économat parce que il y en a qui se servent...
* l'obligation d'apprendre par coeur les cours de la bourse puis les réciter à haute voix en remontant les Champs Elysées
* L'obligation de partir en randonnée en 4X4 à Madagascar avec René (sans les filles)
µµsponsorisé par [le club SM de Brie Comte Robert (F77170)|ListeDesListesSponsoriseesParLeSmClubDeBrieComteRobert]µµ
AmourDesListesEtOrguesDeux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Simone avait une passion peu commune : elle était adepte d'__##hylozoïsme##__. Cette passion la consumait. Elle avait acheté et dévoré tous les ouvrages traitant de cette discipline, parcouru grâce à [Google|http://www.google.fr/search?hl=fr&ie=UTF-8&q=hylozo%C3%AFsme&btnG=Rechercher&meta=lr%3Dlang_fr] toute la Toile, créé un [forum|http://groups.msn.com/HYLOZOISME/general.msnw?action=get_message&mview=0&ID_Message=2] permettant aux aficionados de partager leurs dernières trouvailles, créé un [site internet|http://groups.msn.com/HYLOZOISME/_whatsnew.msnw] anthologique et enfin créé une [bal|mailto:simone_abeille@msn.com] pour recueillir les suggestions de ses pairs...
Pendant qu'elle réfléchisssait, sa BAL clignota de nouveau et un [autre message|http://groups.msn.com/HYLOZOISME/general.msnw?action=get_message&mview=0&ID_Message=4&LastModified=4675481215313710277&all_topics=0#RepliesBookMark] apparu.
Elle regarda la pendule. Mince ! déjà 18h ! Il était plus que temps de se préparer pour le rendez-vous...
Quatre heures plus tard, elle considérait d'un air philosophe la bouteille de loupiac vide sur la table du café. Soit il lui avait posé un lapin, mais pour quelle raison, après s'être montré si insistant ? Soit, il avait eu un empêchement... N'importe comment, il ne viendrait plus ; elle pouvait rentrer. Elle flottait agréablement sur un nuage jaune d'or et se sentait pleine de petits algorithmes. Rentrer ? Oui, ce serait sans doute raisonnable...Elle cherchait vaguement la clé de l'antivol de son vélo lorsqu'une silhouette [floue|ListeFloue] apparut devant elle.
Elle posa à nouveau son fondement - pardon, sa philosophie - sur un tabouret à 5 pattes quelque peu bancal(les) et se décida sans coup férir, vue l'intense canicule, pour un apérosol.
Simone fut agréablement surprise par le langage châtié de son interlocuteur, langage qui pour lui, n'était, on le verra par la suite qu'un artifice de séduction qui avait depuis longtemps fait ses preuves.''(Serait-il lui aussi atteint de jerphanite ?!)''
Encouragé par ce qu'il perçut comme un soupçon d'intérêt pour son babil infernal - qui l'amènerait (elle) aux portes de l'enfer - mais n'anticipons pas, il entreprit donc de lui débiter ses habituelles fadaises et calembredaines, ses à-peu-près et ses coq-à-l'âne, ses contre-pets et autres coquecigrues, enfin toute la panoplie des jeux de mots laids qui l'avaient rendu célèbre, non seulement de Dunkerque à Tamanrasset du temps du gaullisme triomphant mais aussi de Valparaiso à Mourmensk.
Il lui dit donc tout le plaisir qu'il avait à la cotoyer, l'émotion qu'il ressentait à ses battements de cils diaphanes tels les ailes d'un papillon, la gêne qu'il avait à la deviner rosir comme l'écrevisse en court-bouillon. Il ne lui cacha en fait, et avec les difficultés qu'on imagine, que l'érection qui s'était emparée de ses parties nobles. Erection ''(sans majuscule accentuée)'' superbe, monumentale, inexorable...et tellement douloureuse.
%%Green(Quant à Simone, c'étaient plutôt l'eidétisme et la @@cénesthésie@@ synesthésie qui l'affectaient : devant ses yeux embués, un phrase mystérieuse, composée des nouilles légèrement molles d'un potage aqueux, exhalait l'entétant parfum d'un consommé de chinchard :
%%Mark(tuyaux)%%Les tuyaux...le regard légèrement embué de Simone finit par se poser sur la @@braguette@@ chevillette turgide, turpide et même turbide du surmâle. "Telle est sa @@quéquette@@ bobinette, mais quelle est ma quète ?" s'interrogea-t-elle. (µ''j'ai du légèrement amender. Anastasie.''µ)µµ certes certes, mais pour l'allitération ''"Telle est sa quéquette, mais quelle est ma quète ?"'', c'est quand même plus @@couillu@@ jouffluµµ
Turbide, turbide, vous avez dit [turbine|http://www.adele.cafewiki.org/index.php?SurLesTurbines] ? s'exclama Simone eu comble de l'émotion. µµ--nonononon, je n'ai jamais dit ''turbine'', pas plus que ''turgine'' ou ''[turpine|ListeDePoilsAu]'', d'ailleurs--µµCe mot avait le pouvoir de déclencher en elle un émoi et une appétence non contrôlés, de même que "neutrino" par exemple.
"Calme-toi petite !" dit d'un air bourru le vieux baroudeur à la peau tannée par le soleil du désert. Au fait, permets moi de me présenter, je m'appelle Brougnard, Georges Brougnard".
Georges Brougnard, homme au sang chaud, pensa (c'est vraiment pour vous faire plaisir) : indubitablement, cet homme m'a dans le nez ! Lui qui s'était fait tout miel pour séduire Simone Abeille (forcement) fut surpris par l'ire du blouson noir. Et si ce dernier s'était trompé d'époque, de lieu, d'histoire même ?
Il se releva en s'épongeant le sang qui coulait de ses narines avec son vieux mouchoir à carreau %%Red((un seul ?!!!)%%) qui lui servait d'ordinaire à essuyer le surplus de cambouis des entrailles de son 4 X 4 qu'il bichonnait amoureusement. C'est là, vous l'aurez noté chers lecteurs, qu'apparaît toute l'ambiguïté du personnage de Georges Brougnard. Toute sa complexité. GB, comme l'appellent affectueusement ses amis écholaliens, roule en 4x4 nul ne peut l'ignorer, mais IL PORTE UN CASQUE DE MOTO. %%Red((lui aussi ?!!! mais ça n'explique pas la chaise renversée !)%% Ah ! Insondables mystères de la nature humaine ! Déroutantes arcanes de l'âme qui rendent perplexes plus d'un observateur et justifient - ô combien - les tarifs élevés des Schmocks new-yorkais.
"Ah ah, ma qué enfin yé té rétrrouve, infame Brougnardo, (bien sûr, le Chorizo Masqué parle avec l'accent español, c'est normal!), Tou as toué mon père, et yé dois mé venger... en garde!"
"Et moi alors ? quelqu'un s'occupe de moi ?!!" s'écria alors le motard qui, s'étant mis dans une position de garde parfaite que n'aurait pas désavouée le grand Ray Leonard plus connu sous le pseudo de « Sugar », attendait toujours la réaction de GB à son direct du gauche (eh, oui !).
Mal lui en prit car, dans un même élan, retrouvant une complicité fugace de vieux baroudeurs, les deux précédents antagonistes, sans s'être concertés, le soulevèrent l'un par les pieds, l'autre par les aisselles et le balancèrent par la fenêtre restée ouverte par ces temps caniculaires. Simone n'écoutant que son bon coeur se précipita dehors pour voir s'il n'avait besoin de rien.
Tandis qu'elle se penchait sur le beau visage meurtri à la joue violette et gonflée µµ%%Blue((par le coup de poing sur le nez ?))%%µµ, µµ%%Red((mais non ! de sa chute par la fenêtre !))%%µµ il approcha brusquement ses lèvres des siennes et l'embrassa fougueusement. "Oh Simone ! En voiture..."
C'est alors que le portable de Simone sonna : "Oh j'ai reçu un email ! Attendez !". Grâce aux perfectionnements de la technologie, Simone pouvait consulter ses mails directement à partir de son mobile. Tandis qu'elle ###__[en|http://groups.msn.com/HYLOZOISME/general.msnw?action=get_message&mview=1&ID_Message=8]__### prenait connaisance, son visage s'empourpra et s'assombrit tout à la fois... D'un air résolu, elle fit signe au motard de la suivre et retourna dans le bar. Les deux belligérants de tout à l'heure étaient attablés devant des demis et riant à corps perdu paraissaient s'entendre comme larrons en foire.
"Maintenant, posons cartes sur table" dit-elle d'une voix rendue suraiguë par l'exaspération tout en l'invitant à s'asseoir face aux deux comparses, "dites-nous clairement QUI vous êtes ! Vieux motard que j'aimais."
ListeDeTubes
/*Par pitié pas d'images de gros tubes, merci bien beaucoup....
%%Center(étrangeté : la plupart des tubes contiennent des trucs féminins)%%
ListeDesPseudosDesDanseusesDuCrazyHorse
/*attention par pitié ne metez pas de liens vers des grosses danseuses...
%%Center(µµcabaret fondé en 1951 par Alain Bernardinµµ)%% [http://sachatchenko.voila.net/Crazyhorse.jpg]
* Bertha Von Paraboum
* Lily Paramount
* Bertha Von Paraboum 1959
* Lily Paramount 1974
* Sunny Paradis 1975
* Nora Parabellum 1982
* Melba Parachute 1982
* Tuba Parasol 1984
* Monday Parthenon 1986
* Corah Parabellum 1987
* Zia Paparazzi 1995
*µExtrait du roman de Raphaële Vidaling "[Plusieurs fois par moi|http://www.grasset.fr/auteurs/2002-vidaling.htm]", Grasset, 2002.µ
*[sur le site officiel|http://www.lecrazyhorseparis.com/historique/right_creatures.htm]
**...oui, j'ai vu un reportage télévisé il y a deux/trois ans... Et il y en avait même un Crazy Horse ter, à @@Saint@@... euh plutôt seins gars pour... mais les gars de la bas, (à Singapour, vous aviez compris) n'étaient en fait pas si "pour" que ça... en fait le spectacle était trop denudé pour que la clientèle asiatique ose s'y rendre... 5 gars pour, quand tous les autres sont contre, la salle était loin d'avoir atteint le seuil de rentabilité... La su-cul'R sale a donc fermé... Dommage pour eux !... (PS : J'avais remarqué dans le reportage une %%Red(rousse)%% magnifique qui faisait partie du show de Singapour... si maintenant, elle est à Paris, j'aimerais bien avoir son portable !... ;-) )
*Vous qui paraissez bon en listes, vous ne pourriez pas établir également la liste de leurs numéros de téléphone ?
ListeDeSuperstitions
/* par PITIE ne mettez pas de liens vers de GROS superstitieux. merci
* On ne chante pas de __cantique__ chez soi (sauf si on apprend les paroles)
* Il ne faut pas faire tomber un __couteau__ par terre, cela signifie qu'un homme viendra chez vous apporter une mauvaise nouvelle
* Une personne vient de mourir. Arrêtez de suite toutes les __horloges__ de la maison. Cela indique au mort que son action sur terre est terminée et qu'il peut partir.
* Ce que l'on fait bien le __jour de l'an__, on le fera toute l'année. Et ce que l'on fera mal ce jour-là, on le fera aussi toute l'année. Si vous rencontrez un bossu ce jour-là, c'est un bon signe pour le reste de l'année, il faut lui toucher la bosse et lui offrir à boire. Par contre, il est de mauvais augure que la première personne rencontrée soit une femme.
** ''ça n'est pas du tout une superstition au départ, mais ça peut le devenir pour ceux qui n'ont pas écouté : plus simplement "reprendre du poil de la bête" (ou "du chien qui m'a mordu") signifie que le meilleur moyen pour sortir d'une gueule de bois est de s'envoyer un godet de la même mixture que la veille !'' -- µµvous pouvez essayer, ça marcheµµ
* Le sifflement dans les __oreilles__ désigne qu'on parle de nous : si cela a lieu à l'oreille droite, c'est un ami ; si on l'éprouve à la gauche, c'est un ennemi.
* On ne doit jamais prêter son __peigne__, sinon la chance partira avec. Si vous en trouvez un, la chance vous sourira, à condition de ne pas l'utiliser.
*Ouvrir un __parapluie__ dans un intérieur -- µµMalheur aux lustresµµ
* Poser son __sac à main__ à même le sol porte malheur.µµ''(Sac par terre, la misère)''µµ
* Si vous renversez du __sel__ de la salière, malheur à vous... sauf si vous jetez vite une pincée de sel par-dessus votre [épaule|http://mapage.noos.fr/echolalie/type.htm] gauche pour éloigner les mauvais esprits !
* Si vous voulez des __statuettes représentant un éléphant__ à la maison, il en faut une achetée, une volée et une autre offerte par quelqu'un.
* Se partager la corde d'un pendu : "''Du pendu, partageons-nous la corde, c'est du bonheur pour la maison !''"
* Au Portugal, parce que si l'on coupe une banane en deux apparaît sur la tranche le dessin d'une croix, certains habitants refusent d'en manger.
* En Ecosse, lorsqu'ils rencontrent avant l'aube en allant au port, une femme nus pieds, aux orteils longs et larges, les pêcheurs préfèrent ne pas partir en mer. Il est de bon présage de rencontrer le matin une femme de mauvaise réputation, cela signifie que la journée sera heureuse. Par contre la journée s'annonce mal, si cette femme est vertueuse
* Il est conseillé de porter sa veste à l'envers au moment de partir à la chasse à l'escargot, vous serez ainsi assuré d'une prise nombreuse.
* Le spiritisme avec les tables qui tournent (et pourtant [Victor Hugo|http://www.jchr.be/paranormal/notices.htm#hugospir] se passionna pour la chose, [voir aussi ici.| ListeDesEspritsAccueillisOuConvoquesDurantlExilDeVictorHugoaJersey])[http://home.nordnet.fr/~aporet/223haut.jpg]
*Selon Grégoire de Tours et Saint Augustin, il faut ouvrir la Bible au hasard lorsque l'on est dans l'embarras, et la première phrase qu'on y lira devrait donner la solution à notre problème ! ''C’est ainsi qu’un jour un homme se pendit dans la forêt de St Germain, il cru entendre une voix et par peur d’être damné, réussit à se dépendre. Il se souvint alors des conseils de Grégoire de Tours et de Saint Augustin, il ouvrit alors la Bible au hasard et lu ceci :''
* Ne pas faire de feu le samedi µ(par contre t'as le droit de faire chauffer ton frichti par le voisin goy...)µ
*[Le culte du cargo|http://marjorie-art.voila.net/John_Frum.htm] : Dans le culte du cargo mélanésien, croyance millénariste selon laquelle arrivera un jour un navire chargé de biens matériels, les objets les plus divers revêtent une signification socioreligieuse particulière. À Vanuatu notamment, les photos du duc d'Édimbourg font l'objet d'une véritable vénération. [http://marjorie-art.voila.net/images/Vanuatu.jpg]
**On n'appareille jamais un vendredi.
**Monter avec un ecclésiastique porte malheur (parfois ça porte malheur à l'ecclésiastique, cf le cas [Daniélou|ListeAnecdotiquesDesRuesDeParisOuDailleurs])
***Mais non! Sur un bateau il ne faut pas dire "corde" simplement parce qu'il n'y a pas de cordes mais des bouts, et chacun porte un nom précis : on risque seulement de passer pour un marin d'eau douce... En revanche, on risque de faire sombrer le bateau si on prononce le mot "lapin". (voir marine) Et au théâtre il n'y a pas non plus de cordes mais des guindes. Pour avoir du succès : dire « ficelle ».
** Dans un grand nombre on dit encore, lorsque la Noël tombe le vendredi, que le cimetière en aura sa part ; ce qui signifie que l'autorisation de faire gras un tel jour doit amener une grande mortalité pendant l'année.(Vosges)
** Il est accrédité, dans quelques endroits, que le soir, dans l'été, on entend parfois, dans les airs, une troupe de musiciens qu'il est fort dangereux de rencontrer. On l'appelle Mouhiheuken ; il faut, pour ne pas en être mis en morceaux, se coucher le ventre contre terre. (Vosges)
** Quand un chef de famille décède, on est dans l'usage, dans presque toute la contrée, de suspendre aux ruches une étoffe noire ; les abeilles, sans cela, partiraient dans les neuf jours. Dans quelques endroits, on leur met aussi un morceau d'étoffe de couleur, un jour de mariage, pour leur faire partager la joie. (Vosges)
** Une jeune fille désire-t-elle connaître l'époux qui lui est destiné ? Il faut qu'une de ses amies glisse, tout à fait à son insu, dans son sac à ouvrage et le jour de la Saint André, une pomme de l'année. La jeune fille la doit manger en se couchant et en ayant soin de dire avant de dormir : « Saint André, faites-moi voir celui qui m'est réservé ! » et le jeune homme lui apparaît dans un songe. (Vosges)
**µµce qui n'empêche pas les charlatans de déclarer le plus sérieusement du monde : La 1ère origine vient du triangle que l'échelle forme avec le mur. Entrer dans ce triangle magique signifie le profaner. D'autre part, plus "scientifiquement", un angle droit émet un champ de vibrations négatives dans l'axe de sa bissectrice, ce qui affecterait le psychismeµµ
*Parler de "corde" dans la maison d'un pendu : ''simplement une façon de dire qu'il faut éviter de parler des sujets qui fâchent ou qui peuvent contrarier...''
* Une même allumette ne doit pas allumer 3 cigarettes (c'est pas de la superstition : cela fait partie des règles de sécurité en cas de guerre, car un tireur embusqué, à la première cigarette allumée il vous repère, à la seconde il vise et à la troisième il tire... et vous tue)
* Le mec il était hyper-protégé, il se baladait avec plein d'allumettes partout sur lui. ''brève de comptoir''
* Par superstition, les portugaises ne se rasent pas sous les échelles :-)
*La superstition est un peu plus humaine que la religion, parce qu'elle manque de morale. ''Rémy de Gourmont''
** ce n'est pas une superstition, c'est une légende... puisque rien de sacré, de démoniaque ou de paranormal ne s'y rattache... ceci dit, ça ne marche pas !
* Un parapluie et une machine à coudre sur une table de dissection µµ([la preuve)|http://breton.calmelscohen.com/]µµ
[http://marjorie-art.voila.net/paraflote.jpg]
µµcréée par un sympathique anonyme et enrichie par plusieurs contributeurs qui ne croient pas aux superstitions (__parce que y croire porte malheur__)µµ
/* réparée après effacement malencontreux (Ne jamais laisser une liste vide, ça porte malheur)
ListeDesIngredientsPouvantEntrerDansLaCompositionDunShampooing
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeChansonsDeDalida
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# C'est irréparable.
# Gigi in Paradisco.
# Ils sont partis.
# Je pars.
# La partie de Football.
# Parce que je ne t'aime plus.
# Pardon.
# Parle plus bas. (1972 - Musique de Nino Rota, théme du film "Le Parrain")
# Parlez-moi d'amour mon amour.
# Parlez-moi d'amour.
# Parlez-moi de lui.
# Paroles, paroles. (1973 et avec Alain Delon... tout le monde peut se tromper)
# Pars.
# Partir ou mourir.
# Quelque part au soleil.
# Scandale dans la famille. (crée en 1965 par Sacha Distel, repris par la compagnie crèole en 1986)
# Tables séparées.
# Toi pardonne-moi.
# Zoum, zoum, zoum [http://www.zboray.com/graves/images/Paris/Mortmartre/dalida03.jpg]
ListeDeLivresIntrouvablesOuEnRuptureDeStock
/* par PITIE ne mettez pas de liens vers de GROS bouquins. merci
* Objectif Pollux de E.C Tubb ''et d'une façon générale tous les bouquins SF parus aux éditions Ditis''
* Le curieux : un roman policier écrit en 1987 par Jean-Louis Debré dans lequel une prostituée s'appelle... Josiane Baladur (avec un seul l). Depuis les Balladur et les Debré ne s'adressent plus la parole ! Mais pour trouver le bouquin...
* ''Que sais-je ?'' L'astrologie, par Paul Couderc. Première édition. Cette édition a été écrite par un vrai astronome et démontre l'imposture des marchands de soupe. Les éditions suivantes ont été écrites par des astrologues, vrais marchands de soupe donc. µ(j'en ai un, trouvé au marché du parc G.Brassens) -- j'ai perdu mon exemplaire :-( µ µµ(vtzid?)µµ
* Terre des Hommes, de Saint Exupéry - en édition brochée - édité seulement en poche, introuvable en broché chez les libraires comme chez les bouquinistes, mais trouvé sur un site web d'éditions rares (pas visible, donc pour l'état du livre, c'est le coup de poker)µµ Ce n'est pas un coup de poker : tu choisis un vrai professionnel, un exemplaire avec une description et un prix qui te conviennent. Tu as tous les droits de l'acheteur par correspondance, si ça ne te plait pas tu renvoies et on te rembourse, c'est très simple! µµ
* Geste et opinion du Dr Faustroll, pataphysicien / par Alfred Jarry (publication posthume) / édition Gallimard poésie (ce ne serait pas du
* "Le capital aux pinces d'or", un remake de Tintin et "le crabe aux pinces d'or" détourné par l'internationale situationniste, desespérément introuvable...
* "La chasse spirituelle", un Rimbaud apocryphe, mais assez plausible (sauf pour André Breton qui déclara avoir vu tout de suite la supercherie)- feuilleté une fois chez un bouquiniste dans les années 80, mais c'était déjà hors de prix...%%Red(µ(Euh...hors de prix comment ?? parce que je l'ai retrouvé dans ma bibliothèque :-)édit. 1949) - D'occasion à partir de EUR 73,00 sur Amazon)µ(*))%%
* "La Disparition" de Georges Perec. Editions Gallimard L'Imaginaire du 3 avril 2003 avec 4 ''E''µµ(''enfin, j'espère...)(pfff non, y en a encore..)µµµµ
ListeDeCules
/*Par pitié pas de... bon bous avez compris ?
* antiparticule
***ou "Avancez vers l'arrière" comme disent les conducteurs de bus à Paris qui n'osent pas employer de mot en ul !
* particule
*Ce ridicule testicule, animalcule, vésicule ou tubercule bouscule et gesticule les groupuscules de particules. Je calcule : ridicule renoncule.
*Cette liste est bien pauvre, je trouve que l'utilisation abusive du Quériword peut tuer une liste. %%Smiley(AR15firing)%% On pourra toujours aller voir en restant dans un domaine fort proche [celle-ci qui s'essaie à la poésie|ListeDalexandrinsFinissantParLeSonUle]
[Application pratique dans les alexandrins|ListeDalexandrinsFinissantParLeSonUle]
ListedeGensBetes
/*Par pitié pas de Gros Gens bêtes ! Merci
ListeDeFeuilletonsEnNoirEtBlanc
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Seule à Paris
ListeDeRobots
/* par PITIE ne mettez pas de liens vers de GROS robots. merci
*%%Blue(They are mobile, they can find you, they can talk to you and ask you questions. They can interact with you, see you, they seem to be intelligent. They explain the exhibits to you, show you around, they can introduce you to their colleagues and to robotics researchers on site. And they are interested in what you think about them.%%% %%% µµ"(Ils sont mobiles, ils peuvent vous trouver, ils peuvent vous parler et vous poser des questions. Ils peuvent agir réciproquement avec vous, vous voir, ils semblent être intelligents. Ils vous expliquent les expositions, vous montrent autour, ils peuvent vous présenter à leurs collègues et aux chercheurs de robotique sur le site. Et ils sont intéressés par ce que vous leur pensez.)"µµ)%%
* Trois lois fondamentales définies par Asimov
* et ceux qu'on oublie toujours, les trois émouvants petits robots de "Silent Running" (Huey, Duey & Luie) µµet comme ils arrivent en dernier, ce sont eux les premiers ! R2D2 pissait encore de l'huile dans son carter quand eux se faisaient déjà réparer !µµ
* A.I. de Spielberg (2001), d'après Brian Aldiss (projet de Kubrick au départ), dans lequel Spielberg revisite le mythe de Pinocchio.
* Astro Boy, créé par Osamu Tezuka [http://www.alphalink.com.au/~roglen/Astroboy150A4.gif]
* Atom Suit, le costume atomique conçu par Kenji Yanobe [http://www.undo.net/Emailart/img/mostre/180x224/32.jpg]
* automates fabriqués par Jacques Vaucanson vers 1740 : le Joueur de flûte, [http://history.sandiego.edu/gen/recording/pix/vaucanson.jpg] et le Canard qui digère[http://www.stanford.edu/group/SHR/4-2/images/MAZLISH1.GIF]
* Charles Babbage, premier concepteur d'un calculateur analytique (1863), ''bien aidé par Ada, Augusta Adélaïde Byron, comtesse de [Lovelace|http://www.internenettes.fr/femme/ada.html]''... [http://www.charlesbabbage.net/different-engine-2.jpg]
* K9 assistant du Dr WHO (joué par Tom Baker) (1977) [http://news.bbc.co.uk/olmedia/1110000/images/_1113537_k9bbc.jpg]
* Karel Capek, l'homme qui (dans la propre ville du Golem) inventa le mot « robot » en 1921 pour sa pièce "Robots universels de Rossum" (le mot signifie paraît-il "travail forcé") [http://www.zvedavec.org/images/autori/capek.jpg] [http://www.liceomarinelli.it/attivita/teatro/2007/RUR-Capek-1920.jpg]
* cybernétique : premières applications réalisées par Ross Ashby, Pierre de Latil, Albert Ducrocq, Couffignal, Sauvan (1950)
* Deep blue, l'ordinateur qui a battu Kasparov [http://www.inforchess.com/compulib/graficos/KasparovDeep1.gif]
* Galatée fabriquée par Pygmalion à partir de l'argile [http://marenostrum.org/bibliotecadelmar/mitologia/imagenes/galatea.jpg]
*__ HAL 9000__ (le nom prend les lettres qui précèdent IBM), l'ordinateur de "2001, Odyssée de l'espace" conçu par Kubrick et A.C.Clarke (1968)
** "Certains hommes d'affaires, tel Chris Willis, PDG de la compagnie Androïds Worlds (...) ne s'embarrassent pas de morale. Quand je lui ai demandé si, par exemple, remplacer votre père mort par une réplique artificielle n'allait pas sans risques psychologiques graves, ni même sans bousculer l'éthique, il m'a répondu : «Je ne vois pas un risque, je vois un marché !» (Daniel Ichbiah, Le Figaro littéraire, 12-05-05)
* Patrouille galactique commandée par télépathie, imaginée en 1937 par l'inventeur du "space opera" : E.E."Doc" Smith [http://nikosolo.voila.net/SF_art/Galactic_patrol.jpg]
* P3 construit par Honda en 1997 [http://rps3.com/Images/Pages/Robots%20-%20Honda%20P3/Images/ro_p3_3.jpg]
* Ranxerox et ses photocopies de sentiments, par Tamburini et Liberatore
* Robotophilie : [perversion|ListeDePerversions] sexuelle s'exprimant par une passion immodérée pour les robots [http://sachatchenko.voila.net/Robotophilie.jpg]
* Roboroo dévelloppé par le constructeur de voitures Holden en Australie pour tester les accidents avec les kangourous (1994)
* robot féminin par Surayama [http://digilander.libero.it/manuelhood/donna2000/robot2.jpg]
* robot servi par une soubrette nue [http://nikosolo.voila.net/SF_art/NakedMaid_Robot.jpg]
** La robotique est un projet d'exposition de la distance diminuante entre la technologie robotisée et l'homme. Des robots industriels, comme la recherche et maintenant économiquement la branche de robotique couronnée de succès, sont sur le point d'être suivis par la génération suivante : robots personnels. Ils entrent aux domaines domestiques(intérieurs) et émotionnels et développent des relations affectives à leurs utilisateurs. Et le dernier, final interviennent cette succession est aussi déjà fait : Cyborg robotique, la fusion de technologie robotisée et le corps humain. Les robots deviennent biocompatible
(texte traduit automatiquement par un robot)
* Steve Austin, l'homme bionique qui valait trois milliards (Mais non 'tain, regarde l'affiche : il valait 6 milliards !!! -'' Ceux qui étaient enfants à l'époque de gloire de la série se souviendront qu'il est "The 6 million $ man" au générique, mais que le titre officiel en France est bien "L'homme qui valait 3 milliards", même qu'on l'appelait "l'homme qui valait 3 mollards" dans la cour de récré, et qu'il était interprété par Lee Majors, le mari de Farah Facett, et d'ailleurs la série marchait si bien qu'il y a eu une version féminine de Steve Austin : Super-Jaimie. Une autre remarque ?'')
* Talos, gardien de métal fabriqué par Héphaïstos [http://www.vacation-crete.com/general/talos.jpg]
* tortues électriques produites par Grey Walters (1948)
* Valerie, [la femme androïde|http://www.androidworld.co]. Elle est belle et docile... Cette humanoïde est très intelligente. Elle parle 7 langues, fait le ménage, la vaisselle, met la table, s’habille et se déshabille toute seule sans broncher ! C’est le robot le plus élaboré à l’heure actuelle. Grande, fine et élégante, Valérie possède un physique de mannequin et un timbre voix suave, très proche de celui d'une femme. On ne sait pas si elle possède toutes les qualités féminines mais les savants fous ne comptent pas s’arrêter en si bon chemin... Jusqu’où iront-ils ? En attendant, cette charmante poupée fait très mal au portefeuille ! Comptez 59 000 dollars pour vous s'offrir Blanche Neige !
Mitsubishi Heavy Industries (MHI) a présenté son petit dernier : __Wakamaru__, un robot humanoïde (sur roues d'un mètre de haut et 30 kg ) qui est destiné à aider les personnes âgées. Il communique avec elles en comprenant plus de 10 000 mots et est capable de reconnaître 2 maîtres et 8 autres personnes. Connecté sur internet en permanence, il peut s'occuper de renouveler une ordonnance, prendre rendez-vous chez le médecin ou encore donner l'alerte. Il devrait être commercialisé en 2004 pour un prix avoisinant le million de yens (environ 7700 euros). MHI compte en vendre 10 000 exemplaires par an.
Déjà présents en 2002, les sociétés Tmsuk et Sanyo ont présenté la nouvelle version de leur robot-gardien de maison : __Banryu__. Ce robot dont le développement à commencé en 2001 pèse une quarantaine de kilos. Il parcourt 3 à 15 mètres par minute et peut franchir des marches dont la hauteur n'excède pas 15 cm. Ce quadrupède au look de dragon est aujourd'hui doté d'une cinquantaine de capteurs qui lui permettent de détecter des odeurs, d'écouter, de voir ou de connaître la température ambiante... Il signale ainsi la présence d'intrus et prévient les fuites de gaz ou les incendies.
Selon l'un de ses créateurs, __Ifbot__ est le robot le plus doué pour communiquer. Il possède plus de 10 000 mots et s'enrichit continuellement de nouveaux mots. Il est capable d'apprendre les habitudes et de cerner la personnalité de son propriétaire. Il décèle les émotions de son interlocuteur, reconnaît une quarantaine d'expressions faciales et peut distinguer jusqu'à 10 personnes. Ce robot de 45cm de haut et à l'allure d'astronaute pèse 7 kg et est capable de se déplacer, d'éviter les obstacles et de percevoir les marches. Il est d'ores et déjà en vente pour 500.000 yens. Mais comme beaucoup de robots présents à ce salon, il ne parle que le japonais.
%%Blue(µµBidouillé par Damien P + plein d'autres !!! -- deux heures pour réinitialiser tous les liens morts ! La galère, mais c'est tout joli, maintenant! -- et restauré de nouveau le 25/10/07, c'est bien joli de faire des belles listes mais il faut les maintenir...µµ)%%
ListePourVisiterlEnfer
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center( La part des chiens)%%
*Des juges impartiaux (Minos, Eaque et Rhadamante)
*Ses accès par des moyens de transports modernes
**par la route
**par le train[http://www.affichescinema.com/insc_t/train_enfer.jpg]
**par la mer
**par avion [http://www.lumiere.org/films/images/con-air-fr.jpg]
**Par le passage [http://img.priceminister.com/photo/409598730_L.jpg]
**Par la porte
*Ses 9 compartiments
%%Center(µµ Bettie Page par Olivia De Berardinis µµ)%%
* Et pour un accès sans forfait, sans abonnement, sans pitié
!%%Center(Liste sponsorisée par)%%
ListeDeChampignons
/*Par pitié pas de gros champignons, merci
* Les champignons poussent dans les endroits humides. C'est pourquoi ils ont la forme d'un parapluie. ''Alphonse Allais''
**µ''Repris par [Coluche|ListeDeColucheries]'' : Le champignon le plus vénéneux, c'est celui qu'on trouve dans les voitures.µ
* Champignons [candides|http://arachosia.univ-lille2.fr/labos/parasito/Candida.html]
* Champignons de Paris [http://www.tachenon.com/Agaric/paris.jpg]
* Le champignon hallucinogène mangé par cet imbécile de Rantanplan dans "L'héritage de Rantanplan"
* Le champignon parapluie (spécial schtroumpf) [http://www.schtroumpfs.org/schtroumpfs-catalogue/catalogue/schtroumpf-champignon.jpg]
**(à la fin de la chanson éponyme de Francis Lalanne, il y a une petite voix de gamin(e) qui dit : « oh ! le champignon nucléraire !... ») (éponyme parce que le titre de la chanson, c'est "le champignon nucléaire", le titre de la chanson, c'est pas Francis Lalanne, hein !...)µµ et si tu parlais comme tout le monde tu n'aurais pas eu besoin de nous gratifier d'un retour sur explications !µµ[http://www.dissident-media.org/infonucleaire/jpg_bombe_atomique/File0003_petit.jpg]
Liste agréée par le [Comité de défense des légumes|ListeDuComiteDeDefenseDesLegumes]
µµRamassés par Jegµµ
ListeSubliminale
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDebilitanteEtDemoralisanteDePlusRien
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Apparemment, plus rien ne vous choque... Claire, service d’orientation en alerte (15-06-04)
* Il n'y a plus rien avec la douleur (Bertrand Cantat, Paris Match, 19/08/2004)
* Plus rien n’apparaît dans l’onglet (Wilders Security Forums)
FooBar
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*13/11/%%Querynum(1940,1949)%% Naissance à %%Querylist(Tarbes,Kuala-Lumpur,Paris XXèm,Hazebrouck,Bratislava)%%
*%%Querynum(1985,1995)%% A la suite d'un voyage à Madagascar, défie Kasparov pour le titre mondial
** Kasparov ne l'a jamais battu
ListeDesListesDeListesTrouveesSurLeNet
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Liste des sénateurs par ordre Alphabétique
** Représentation graphique par région
** Liste des sénateurs parpartement
** Listes des sénateurs par série : A - B - C
** Liste par commission, par délégation, par office
** Liste par groupe
** Liste des sénateurs par catégories professionnelles
ListeDeRingardsAuthentiques
*µµ n. __ringard__ au masc. sing.µµ%%% µµ (Familier) Artiste démodé, qui n'est plus dans le vent. (Par extension) Personne nulle, sans talent, sans capacités.µµ
*µµ Le ringard se reconnaît aussi à sa participation à d'innombrables navets, fours, bides, émissions ringardes ou animations de supermarchés. Autres lieux de prédilection : l'émission La Classe, l'émission Les Jeux de 20h, les grosses têtes (pour certains) %%Red(bof ! tant qu'ils se mettent pas à faire des listes...)%%µµ
*Charly Oleg (ah non pitié, pas lui !) [http://www.stars-oubliees.com/IMG/arton98.jpg]
*Jean Topart
*Les Freres et demi (pardon les frères ennemis)
* Philippe Nadeau (et pas Bruneau) - Pourtant non dénué de talent, voir par exemple son rôle dans le film "Les Babas-cool" : "Tu devrais en parler à cette adorable femme aux grands yeux bleus, c'est ma femme"
** On n'a pas dit qu'il était dénué de talent, on a dit qu'il était franchement ringard, en particulier à l'époque où il faisait des sketches chez Stéphane Collaro.
*Thierry Roland[http://tvmag.tvimg.partner-tvmag.net/ImCon/Arti/34175/thierry-roland.jpg]
ListedActesManques
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Un homme masqué par un bas sur le visage tentait de voler la caisse d'un supermarché. Une caissière actionna avec le pied le signal qui prévient la police. Un car se trouvait à proximité et se rendit immédiatement sur les lieux. Le malfaiteur, paniqué, attrapa rapidement un panier et fit semblant de faire ses courses en prenant un air le plus dégagé possible... Il a tout de même été appréhendé quelques minutes après, il avait tout simplement oublié de retirer le bas qu'il portait sur la tête... [http://www.objectif-cinema.com/horschamps/images/060/Fantomas_08.jpg]
* Perdre sa clef de vélo cinq minutes avant de partir pour un rendez-vous avec Mme J. (C'est pas un acte manqué mais seulement la manifestation du désir de perdre quelques kilos d'embonpoint en y allant à pied - parce que vraiment tu t'laisses aller en ce moment)
* Oublier son sac/écharpe/pull/bonnet/parapluie/__chapeau__/vélo/ chez une personne qu'on aimerait bien revoir et avec qui cette fois-là on n'est pas allé tout à fait jusqu'au bout de ce qu'on aurait pu/voulu/désiré %%Red(µ(1)µ)%%
** µµoui ben la fois ou j'ai vraiment oublié un super pull chez une copine, primo j'ai eu le plus grand mal à lui faire comprendre après que je ne voulais absolument pas aller plus loin avec elle (elle n'a pas épongé mais plutôt essoré trop de mecs --''élégant''--), deuxio elle a considéré que c'était un cadeau, la vache ! et depuis mon ex me fait la gueule parce que c'était un cadeau d'elle...µµ
*Les lapsus peuvent parfois être considérés comme des actes manqués, voir ListeDeLapsusRigolos
ListeDeMembres
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(''__Jamais je ne voudrais faire partie d'un club qui accepterait de m'avoir pour membre.%%%(Groucho Marx)__'')%%
µPour faire valoir mes [revendications|ListeDeRecriminationsSurEcholalie], je désire faire partie de l'association Echolalie, dont les statuts sont [ici|http://www.echolalie.com/1901.htm]. Je viendrai -ou me ferai représenter - à la première AG du 24 du beau moi de mai à 20 heures, où je pourrai boire%%Red( du bloody mary)%%, %%Green(des menthes à l'eau)%%, %%Blue(du blue lagoon)%%, cotiser, manger du couscous, et me faire élire à un poste important. Ou ne pas me présenter à un poste important. Ci-joint mon nom, %%Red(par ordre alphabétique.)%%. La cotisation est de __5 euros__ pour les étudiants et les demandeurs d'emploi, __15 euros__ pour les autres, __20 euros__ pour les énarques. (à confirmer par la première AG). Je recevrai ensuite une belle [carte de membre|ListeDeCartesDeMembre] à mon nom avec un beau [logo|ListedIdeesDeLogosPourPasOublier] dessiné dessus.µ)%%%
%%Green(µ''(bien que je n'aie pas d'affinité particulière envers les énarques, je m'élève contre cet ostracisme. Pourquoi pas tout le monde à 20 euros sauf les étudiants et %%Red(certains chômeurs ? Et y'a t'y un prix pour les retraités ?)%%''µ))%%
** Il sera en cela aidé pour les sous-titres par le délégué aux arts plastiques.
** Le délégué aux bandes dessinées aura à coeur d'explorer les oeuvres du nationaliste paysan Bratislav Demko (1734-1789), en particulier son poême épique "Gorzenmko ur Turj" (mon coeur battant), 12 volumes de versification éminemment allégorique et stylisée. (Les érudits y voient l'une des oeuvres les plus significatives jamaies lues par personne).
** Le délégué à l'oenophilie enquétera sur les coutumes de la fête des vendanges (22 septembre) , lorsque les premières grappes sont foulées aux pieds par une jeune vierge. (faute de la trouver sur place, on la fait venir de Hongrie).
%%Center(%%Red(__ l'Opposition, par des moyens qu'elle ne peut dévoiler ici,%%%a retrouvé cette photo qui en dit long sur le sérieux du candidat;%%%elle émet des doutes sur ses capacités à entretenir notre doux foyer, Echolalie,%%%et le piloter, tel un fier navire, à travers récifs et ouragans...__)%%)%%
Une boîte aux lettres partagée -liste de diffusion - a été créée : echolaliste@echolalie.org. [Ecrivez|mailto:echolalie@echolalie.com] si vous désirez faire partie de cette liste.
ListeDesChosesQuiFacilitentLaVie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Les parapluies
ListeDesTemps
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Imparfait du subjonctif (?) : [chloroformassions|http://mapage.noos.fr/echolalie/l1239.htm]
* La plupart du temps...
* [Le temps de l'amour|http://site.ifrance.com/leparolier/textes/letempsdelamour.htm]
* Le temps passé [(il est toujours joli)|http://www.paroles.net/texte/22468]
* Les temps simples : à présent imparfait, passé et futur simples
* Les temps composés : si le passé composé est plus que parfait, le futur et le passé y sont antérieurs. Sans compter les temps surcomposés et les temps périphrastiques !
ListedAuRevoir
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [Bye bye baby|http://www.speederich.com/MONROEDISQUES/paroles/byebye.htm] !
ListeDeSouris
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Notre ami Mickey a faufilé sa tête dans le plan du parc du château de Versailles : sauras-tu la retrouver ?[http://monberu.milkcafe.to/html/travel/vrs/image/map-b.gif]
* [Quand tu souris|http://www.paroles.net/texte/20812]
* Souris pas partageuse µµ('' Les photos qui illustrent mon site sont ma propriété et je n'accepterai aucunement une copie partielle ou non de mon site web. '')µµ
* Une certaine souris par Anne de Bollène, Série Blonde 1957.[http://lemomo2.pagesperso-orange.fr/Surf/Une_certaine_souris.jpg]
** ''Quand Stalin était dans le bureau, il a par le passé noté qu'il y avait des souris dans son étude et portées plainte au Président Kalinin à ce sujet. La pensée de président pendant un moment et suggérée, "pourquoi pas vous mis vers le haut une lecture 'ferme collective 'de signe ? La moitié des souris mourra de la faim et l'autre moitié fonctionnera loin."''[http://grioo.com/images/rubriques/11/392.jpg]
ListeDeCollections
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Appareils photographiques : Iconomécanophile
* [Enclumes|http://couteaux.free.fr/enclumes/enclume1.html] : %%Red(?)%% pourquoi pas Udisophile ! %%Blue(''"µµTiens une enclume !" est l'expression totale parfaite et facilement mémorisable de ce que les commentateurs de l'Ecole de Birmingham appellent la "[Botul |http://botul.free.fr/] Attitudeµµ"'')%%
* Étiquettes de parfums : Odolabélophile
* Flacons de parfum : Lécythiophile
* [Images pieuses|http://www.magasinpittoresque.be/pieuses/Images-pieuses.htm] (et par extension toutes les "[bondieuseries|ListeDeBondieuseriesAmusantes]" : Canivettiste
* Parapluies : Paraflotophile
* Parfums : Lécythiophile, Odolaphile
* Timbres autres que postaux (et/ou [timbres fantaisistes|ListeDeTimbresFantaisistes]): Paraphilatéliste
* petites maisons bricolées/fabriquées par des mômes (+-10) et des moins jeunes (+-20)
* Appareils à vision stéréo µ''(une 'tite dizaine, j'ai arrêté quand c'est devenu hors de prix)''µ
* Brosses à parquet (+-30)
*pis flute, y en aurait encore des dizaines et je ne vais pas y passer la journée, mais je ne vous lâche pas sans rappeler à vos mémoire le __comte de Caylus__, qui, dans le prolongement des __cabinets de curiosités__ parlait de la ''collection comme instrument de connaissance''.
** parce que selon vous, l'une serait noble et l'autre ne le serait pas ? (''dans l'ordre inverse si je vous suis bien'' :-))
** Non, pas de noblesse plus ou moins grande. Pour moi ramassophile, j'accumule et collectionne des objets qu'on peut trouver sans forcement les chercher, ni les payer (ou alors pas cher). La collectionite commencerait à partir du moment où on fait un détour pour aller chercher un objet, où on est prêt à débourser plus que raisonnable, etc. Mais vous avez peut être un autre avis.
*''Remarque : la collection de listes n'apparait pas dans la ListeDeSuffixes !!µµ(ou alors c'est mes yeux??)µµ''
* Selon le Nouvel Observateur Hors Série n°505HS (paru le 20.04.2005), le __collectionisme__ est une addiction (avec entre autres : addiction sexuelle, cyberdépendance, dépendance affective, addiction aux thérapies, achat compulsif ...) -- et alors ?
µµListe créée par [LP|ListeDeLp], collectionneur de collections ! µµAjoutez, inventez, toutes les collections possiblesµµ
ListeDesChosesQuiCompliquentLaVie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Certaines abréviations, par exemple __A.M.__, on croit que c'est "après-midi", et pis en fait c'est "ante meridiem", ou alors __BSA__, on cherche "Business Software Alliance", et on tombe sur des invitations de jamborées chez les "Boy Scouts of America"...
* Le bouton basculant où il est marqué __O__ - est ce qu'en appuyant dessus ça éteint ou c'est déjà éteint quand on le voit sur cette position ? -- %%Green(Faites excuse, mais je veux pas avoir l'air de critiquer, mais si c'est déjà éteint, on peut pas voir le O sauf si c'est qu'on a des oeils de chat !)%% %%Red(Meuh non, un appareil peut être éteint en pleine lumière)%%
* Les formats propriétaires (c'est-à-dire qui ne vous appartiennent pas mais qu'on veut vous imposer)
* Les modes d'emploi en général (ceux des magnétoscopes et des filles en particulier)
* Les petits [boutons|http://www.paroles.net/texte/21560] de nacre [http://www.jeudemailles.com/images/b18bp.jpg]
* µµ Je me dois de signaler une authentique révolution propulsée par notre champion national (peut-on citer des marques ?). C'est la série des cartes "régionales" 5xx. Elles sont ou plastifiées ou imprimées sur support plastique, je ne saurais dire.
µµ%%Blue(idée de sol.)%% -- reclassé le 11/12/07 par mes mains de féeµµ
ListedHistoiresdElephants
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Fils de Shiva et de Parvati, la fille de l'Himalaya, frère de Skanda, Ganesh fut créé à la demande des dieux, qui voulaient distinguer le bien du mal pour assurer le succès des bonnes entreprises, et l'échec des mauvaises.
** A sa naissance, il était semblable à son père Shiva, homme d'une grande beauté. Aussi oublia-t-il rapidement sa tâche initiale et entreprit de séduire toutes les femmes. Sa mère Parvati le condamna dès lors à avoir une tête d'éléphant et un gros ventre.
** Selon une autre version de l'histoire, sa mère Parvati recherchait un gardien sûr pour garder sa porte. Elle enfanta donc Ganesh à partir des sécrétions de sa peau. Ganesh monte la garde, jusqu'au jour où Shiva vint rendre visite à Parvati, qui était en train de se baigner. Ganesh ne connaît pas Shiva et lui interdit l'entrée. Shiva se met en colère, mais Ganesh tient bon et use de son gourdin pour l'empêcher d'entrer. Shiva appelle à l'aide Vishnou, qui utilise sa maya, c'est à dire l'illusion, pour jeter la confusion et décapite Ganesh avec son trident. Parvati, découvrant le corps de son fils décapité, demande sa renaissance. Aussitôt l'armée de Shiva part en direction du nord, avec pour mission de couper la tête du premier être vivant qu'elle rencontre. C'est un éléphant pourvu d'une seule défense. Shiva pose alors la tête d'éléphant sur le jeune garçon, et lui donne vie par le pouvoir de la parole.
** Ganesh est présenté aux dieux comme le fils de Shiva et de Parvati. La déesse lui offre un plat de gâteaux sucrés (Modaka). Ganesh danse. Attiré par le parfum des sucreries, un rat sort de son trou : il sera le véhicule préféré de Ganesh.
** Par la suite Ganesh épousera les filles de Brahma, Siddhi (la réalisation), et Buddhi (l'intelligence). Elle donneront chacune un fils à Ganesh : Kshema (le bien-être) et Labha (le gain).
** Dans son ventre Ganesh contient tous les mondes, ses grandes oreilles n'entendent que les bonnes paroles, et rejettent les mauvaises.
** Il existe un paradis, situé dans l'océan de jus de cannes à sucre, sur lequel flotte un lotus à mille pétales soutenant le trône d'or de Ganesh.
Offensé, le Dieu de la Pluie arrêta toutes les pluies et les déserts s’élargirent partout. L’éléphant mourait de soif. Il tenta de creuser dans le lit des cours d’eau, mais n’y trouva pas la moindre goutte. N’y tenant plus, il implora le Dieu de la Pluie:
Le coq le chercha partout, et finalement, il le trouva caché derrière un nuage. Il lui dit qui il était, et réclama de la pluie avec tant d’éloquence, que le Dieu décida d’en faire tomber un peu sur la terre.
Le même jour, l’éléphant partit dans le bois pour se nourrir et confia à la tortue la mission de protéger la mare, en lui disant:
L’éléphant parti, de nombreux animaux assoiffés s’approchèrent de la mare, mais la tortue veillait et leur dit:
- Cette eau appartient à Sa Majesté l’éléphant. Vous ne devez pas la boire.
Quand le lion arriva, il ne fut guère impressionné par les propos de la tortue. Il la regarda, lui conseilla de ne pas s’approcher et commença à boire pour étancher sa soif. Puis, il partit sans dire un mot.
- Ne faites pas comme l’éléphant. Ne mettez pas au défi ceux qui sont plus puissants que vous. Ne détruisez pas ce dont vous pourriez avoir besoin dans les années à venir, ne demandez pas à un faible de défendre votre propriété, et ne punissez pas un serviteur innocent. Mais surtout, ne soyez pas arrogant et n’essayez pas de tout vous approprier. Laissez ceux qui en ont besoin partager votre fortune.
**µµLa trentaine d'éléphants domestiques de New-Dehli va être équipée de cataphotes (réflecteurs lumineux, comme sur les vélos) pour éviter les accidents la nuit dans les rues de la ville.Il arrive en effet que des voitures ou des motos s'empaffent sur les gros animaux, qui vivent et broutent en liberté sur les berges de la rivière Yamuna. Des accidents parfois mortels (pour les humains). Ces éléphants, considérés comme des porte-bonheurs, sont utilisés pour des mariages ou autres cérémonies. Il y a environ 33 000 éléphants en Inde, dont 6 000 domestiques.µµ
*** Parce qu'il se sont fait sucer par des canards
ListedExtraTerrestres
/* par PITIE ne mettez pas de liens vers de GROS Extraterrestres. merci
* Les OVNI sont des hallucinations collectives provoquées par des extraterrestres. ''Jacques Bergier''
* Ford [Escort|ListeDeParolesdEscorts] (le Routard galactique)
* L'oiseau martien Tweel, une sorte d'autruche martienne créée par Stanley Weinbaum (A Martian Odyssey, dans le pulp Wonder Stories, Juillet 1934)
* Les créatures de Defontenay (Star, ou Psi de Cassiopée, 1854) µµ''"redécouvert" par R. Queneau en cherchant des chef d'œuvres inconnus à la bibliothèque nationale, c'est en fait très mauvais...''µµ
* Les Skorgs (tout gris), les Arénadinaks (gros et oranges) et les Molilarus (tout mauves) dans Complot contre la Terre un bouquin paru aux édition Ditis dans les années 60 de Calvin M. Knox (en fait Robert Silverberg). Assez primaire mais agréable à lire...
** Ce signal, venant d'un point situé entre les constellations du Poisson et du Bélier, a été capté à trois reprises par le radiotélescope d'Arecibo, à Porto Rico. Les scientifiques sont sceptiques...
** Une civilisation extraterrestre pourrait avoir émis jeudi un message radio. D'après le très sérieux magazine anglais New Scientist, un signal radio particulier, venu d'un point situé entre les constellations du Poisson et du Bélier, a été capté à trois reprises par le radiotélescope d'Arecibo à Porto Rico, dans le cadre du programme SETI (Search for extraterrestrial Intelligence).
** Le signal, très faible, a été émis pendant une minute autour de 1430 mégahertz, l'une des fréquences principales de l'hydrogène supposée être celle que choisirait un E.T. futé pour donner signe de vie. Toutefois, la revue reste prudente et précise que le message énigmatique pourrait avoir été émis par une planète en orbite autour d'une «petite» étoile. Ou par un «produit dérivé» du télescope lui-même
*Calvin: ses parents, son institutrice, Suzy Derkins...
***parce que ce n'est pas un extra terrestre, c'est une mante religieuse !
%%Blue(µImporté par Damien Pµ)%%
ListeDeChansonsInfinimentTristesEtBelles
/* par PITIE ne mettez pas de liens vers de GROSSES images.
* [Un ano de amor|http://www.paroles.net/lyrics/chansons/32827.htm] (Luz Casal, chantée notamment dans le film "Talons aiguilles", à noter que l'original est une chanson en français de Nino Ferrer)
**%%Blue(''Are you lonesome tonight, do you miss me tonight, are you sorry we drifted apart ?'')%%
* As Time goes By (musique et paroles de Herman Hupfeld)
** %%Blue(''Comme elle est partie, Jim a les nerfs/Jimmy boit du gin dans sa Chrysler/La presqu'ile, le boulevard de la mer est con/Comme elle est partie, attention : Jimmy tourne en rond'')%%
* [Ballade en novembre|http://www.paroles.net/chansons/11339.htm] (Anne Vanderlove)
* [Ballade irlandaise|http://www.paroles.net/chansons/29063.htm] (Bourvil)
* [Barbara|http://www.paroles.net/chansons/11382.htm] (Jacques Prévert/Yves Montand)
* La Blanche Biche, par Tri-Yann
**%%Blue(''Et même si je survis/Loin de ton soleil/Je déteste mes nuits/Je hais mes réveils/Ton départ m'a fait mal/Comme un coup de couteau/Dans la peau'')%%
* [ça tourne pas rond dans ma p'tite tête|http://www.paroles.net/chansons/12186.htm] (Francis Blanche/ Odette Laure)
* [ça va...ça vient|http://www.paroles.net/chanson/12190.1] (Boby Lapointe)
* "La Chanson d'Hélène" par Romy Schneider et Piccoli...
* [La chanson de Prévert|http://www.paroles.net/texte/12589] (Serge Gainsbourg)
* Chante une femme (Jean Arnulf/Martine Merri) chanté par Jean Arnulf
* [Chatenay-Malabry |http://www.bestofparoles.com/lyrics.php?code=2916] (Vincent Delerm)
**%%Blue(''Je vous écris / Dans le silence qui s'installe / C'est un dimanche après-midi / Je suis assise dans la grande salle / Les murs de Chatenay-Malabry / Les rires du passé me font mal / Ils sont partis avant midi / Chacun a sa vie c'est normal '')%%
* [Le clown|http://www.paroles.net/texte/12973] (Giani Esposito)
** %%Blue(''D'une petite voix comme il n'en avait jamais eue D'une petite voix comme il n'en avait jamais eue il parle de l'amour de la joie, sans être cru'')%%
* The Cold song (Purcell - version célèbre interprétée par Klaus Nomi)
** %%Blue(''Cré-moé, cré-moé pas, Quéqu'part en Alaska / Y a un phoque qui s'ennuie à maudire / Sa blonde est partie gagner sa vie / Dans un cirque aux Etats-Unis'')%%
* [Contre l'amour|http://www.chez.com/murattextes/madame.htm] (chanté par Isabelle Huppert - musique JL Murat - texte de Mme Deshoulieres)
* Country Girl par Billy Jo Spears (ou Red Dirt Girl, par Emmylou Harris)
***(V.F. par Gloria Lasso : "adieu gueule d'amour j'ai besoin de changer d'air, alors va pleurer des rivières, pleurer des rivières, j'en ai pleuré pour toi naguère..)µµ
* [Cu-Cu-Ru-Cu-Cu Paloma|http://www.mariachi-sol-latino.de/coverband.html] (Grand classique mexicain, chanté par plein de gens, mais c'est la version Caetano Veloso, de loin la plus belle et la plus triste)
* [Dans mon jeune temps|http://www.paroles.net/texte/13529] (Linda Lemay)
** %%Blue(''Dans mon jeune temps je savais pas / Qu'y aurait fallu que j'dise merci / J'irais maintenant l'dire à papa / S'il était pas déjà parti'')%%
* [Deauville sans Trintignant |http://www.paroles.net/chansons/27313.htm] (Vincent Delerm)
** NB : cette chanson (prémonitoire ?) prend évidemment une coloration toute particulière après la mort de Marie Trintignant. (voir par exemple [cet article|http://www.ledevoir.com/2003/08/07/33435.html])
* [Les désespérés|http://www.paroles.net/texte/13821] (Jacques Brel)
** %%Blue(''Ton image me hante, je te parle tout bas Et j'ai le mal d'amour, et j'ai le mal de toi'')%%
*** J'ai pensé qu'il y avait quelque chose que tu ferais ou dirais, essayant de m'inciter à changer d'idée et de rester ; nous n'avons jamais trop parlé de toute façon, mais ne pensons pas deux fois, tout va bien.
**%%Blue(''"dans les paniers d'osier de la salle des ventes, une gloire déchue des folles années trente avait mis aux enchères parmi quelques brocantes un vieux bijou donné par quel amour d'antan... elle cria, je prends je rachète tout ça ce que vous vendez là c'est mon passé à moi ... le marteau retomba sur sa voix suppliante ... le dernier souvenir de ses amours d'antan ... "'')%%
* [L'elixir d'amore|http://www.aria-database.com/translations/elisir23_una.txt] (Gaetano Donizetti, µµsurtout par Enrico Caruso)µµ
*** Une furtive larme apparut dans ses yeux. Ces joyeux jeunes gens qu'elle semblait envier . Que puis je vouloir de plus ? Que puis je vouloir de plus ? Elle m'aime, oui elle m'aime, je le vois, je le vois.
*** Au fait, à qui croyez-vous qu'il parle ? A un personnage exterieur?
**** mais non Jane, c'est sa femme à L., et son frère est venu et, après avoir attendu en vain à la gare Lili Marlène, il est reparti avec Jane, cette nuit où il faisait des plans pour réussir (avait-il un jour réussi ?) et ensuite Jane est revenue auprès de L. avec une boucle de cheveu de son frère, elle n'était plus la femme de personne... Mais maintenant, dans la lettre, il lui pardonne, qu'il est content de le connaitre, parce qu'il comprend que son frère a mis un trouble dans les yeux de Jane, et que lui il n'aurait jamais su. Il l'invite à revenir parce que son ennemi(lui) est endormi et que sa femme est libre. La fin c'est bien ça.
*** Apparemment, [il y a pas mal d'avis sur le sens des paroles|http://www.leonardcohensite.com/songs/famous.htm] ; on n'est pas les seuls à en discuter.
* [La Fanette|http://www.paroles.net/chansons/14859.htm] (Jacques Brel)
*[Les fantômes de Paris|http://www.yves-simon.com/disco/textes/t_fantomes_paris.htm] (Y.Simon)
* [Fernand|http://www.paroles.net/chansons/14990.htm] (Jacques Brel)
** %%Blue('' Mais la vie sépare ceux qui s'aiment/Tout doucement, sans faire de bruit/Et la mer efface sur le sable/Les pas des amants désunis.)%%
* [La Foule|http://www.paroles.net/chansons/15217.htm] (Edith Piaf)
**%%Blue(''Entraînée par la foule qui s'élance/Et qui danse/Une folle farandole/Je suis /emportée au loin/Et je crispe mes poings, maudissant la foule qui me vole/L'homme qu'elle m'avait donné/Et que je n'ai jamais retrouvé...'')%%
* [Gastibelza|http://www.paroles.net/chansons/15341.htm] (Victor Hugo - Georges Brassens)
* [Ces gens là |http://www.paroles.net/chansons/12456.htm] (Jacques Brel)
**%%Blue(''Alors moi je la crois, Monsieur, Pour un instant, Pour un instant seulement, Parce que chez ces gens-là , Monsieur on ne s'en va pas...'')%%
*** Je sais qu'un homme n'est pas censé pleurer, mais ces larmes je ne peux les retenir, te perdre ce serait finir de vivre, parce que tu représentes tellement pour moi...
* [Il n'y a pas d'amour heureux|http://textesbrassens.ifrance.com/textesbrassens/il_n_y_a_pas_d_amour_heureux.html] (Brassens, texte d'Aragon - Egalement chantée par Barbara, Nina Simone et d'autres)
*** Quand ton amour a cessé d'être, il n'y eut plus d'autre place pour moi, Si tu ne me prends pas dans tes bras, je préfère être ici désormais, certains là-bas le sont à moitié, sans ton amour je n'ai nulle part où aller
* In the Ghetto (Scott Davis, µµinterpretée notamment par Elvis Presleyµµ)
* [Jane B.|http://www.paroles.net/chansons/16499.htm] µµ''(Paroles de Serge Gainsbourg, musique de Frédéric Chopin, voix de Jane Birkin)''µµ
* [Jealous guy|http://parolesrock.free.fr/paroles/0210/1003.htm] (John Lennon)
* [Je finirai ma vie à l'Armée du Salut|http://parolesdedimey.free.fr/armeeDuSalut.html] (Bernard Dimey)
* [Je finirai par l'oublier|http://www.ftpk.net/paroles/Nana-Mouskouri/Je-finirai-par-l-oublier/] (Nana Mouskouri)
** %%Blue(Je finirai par l'oublier et par sourire/Vous mes amis vous essayerez de lui mentir/Vous lui direz plus tard aussi/Que notre enfant qui a grandi/Ne parle plus jamais de lui/Ne dites pas la vérié/Ne dites pas qu'il nous faudrait/Plus d'une vie pour l'oublier'')%% [http://news.bbc.co.uk/olmedia/405000/images/_405546_nana150.jpg]
** %%Blue(Je ne suis pas mort, je dors ! Ne m'enterrez pas encore. Je n'suis pas mort : Je dors. Et n'encombrez pas ma mémoire De vos regrets de vos histoires : Je dors...Si quelque part, sait-on jamais, J'avais un ami qui m'aimait, Tant pis. Qu'il m'oublie. Je dors, je dors, je dors.'')%%
*[Je suis venu te dire que je m'en vais|http://www.paroles.net/chansons/16858.htm] (Serge Gainsbourg)
* [J'veux pas qu'tu t'en ailles|http://www.paroles.net/texte/16460] (Michel Jonasz)
**%%Blue(''Y a quelque chose qui cloche d'accord ; Mais y faut voir quoi sans s'énerver ; quelque chose est devenu moche et s'est cassé, va savoir quand ? Moi qui sais pas bien faire le thé ; qu'est-ce que je vais faire ; C'est un détail ; mais... J'veux pas que tu t'en ailles ..Parce-que j'ai attendu beaucoup Et que je t'ai cherchée partout '')%%
* [Je voulais te dire que je 'attends|http://site.ifrance.com/leparolier/textes/jevoulaistedirequejetattends.htm] (Michel Jonasz, Maurane...)
* [Jef|http://dossiers.lesoir.be/brel/paroles/A_040CC4.asp] (Jacques Brel)
*[Jojo|http://dossiers.lesoir.be/brel/paroles/A_041C74.asp] (Jacques Brel)
**%%Blue(''Jojo, Je te quitte au matin Pour de vagues besognes Parmi quelques ivrognes Des amputés du coeur Qui ont trop ouvert les mains. Jojo, Je ne rentre plus nulle part Je m'habille de nos rêves Orphelin jusqu'aux lèvres Mais heureux de savoir Que je te viens déjà Six pieds sous terre Jojo tu n'es pas mort Six pieds sous terre Jojo je t'aime encore '')%%
*[Jolene|http://www.lyricsfreak.com/d/dolly-parton/41709.html] Dolly Parton
**%%Blue(''Jolene, jolene, jolene, jolene/I'm begging of you please don't take my man/Jolene, jolene, jolene, jolene/Please don't take him just because you can/Your beauty is beyond compare/With flaming locks of auburn hair/With ivory skin and eyes of emerald green/Your smile is like a breath of spring/Your voice is soft like summer rain/And I cannot compete with you, jolene'')%%
*** Jolene, Jolene, Jolene, je t'en prie, s'il te plait, ne prends pas mon homme, Jolene, ne le prends pas juste parce que tu peux, ta beauté est comparable là-bas avec les boucles flamboyantes des cheveux auburn, avec la peau d'ivoire et les yeux d'émeraude. ton sourire est comme un souffle, ta voix est douce comme la pluie d'été et je ne peux pas te concurrencer, jolene
*** Elle viendra, elle partira, elle mettra sa confiance en toi, mais elle ne basera pas sa vie sur toi, comment la vie peut-elle devenir son objectif ? elle sera ta fin vivante
* [The last thing of my mind|http://www.youtube.com/watch?v=voqL5ksOuoo] (Tom Paxton, notamment chantée par Judy Collins)
*** C'est une leçon trop dure à apprendre, faite de sable, faite de sable, dan un clin d'oeil mon âme tourne, dans ta main, dans ta main. Pars tu sans un mot d'adieu ? N'y aura t il aucune trace derrière ? Bon j'aurais pu t'aimer mieux. Cela ne veut pas dire être méchant. Tu sais que c'était la dernière chose à laquelle je pensais.
*** S'il vous plaît, dites-moi ce qu'on y a appris, je sais ça paraît absurde, mais dites-moi s'il vous plaît qui je suis...
* Look what they done to my song (Melanie Safka, et aussi Billy Joe Spears qui a remplacé M'ma par Daddy, et aussi Nina Simone, et encore Arno en duo avec Stephan Eicher... Ah ! Dalida et Gloria Lasso aussi, et là cékekchose)
* [Love is just a four letter word|http://www.youtube.com/watch?v=jEE67H9ozbA] (Bob Dylan, chantée par Joan Baez)
*** ''en dehors des balustrades de ma fenêtre, passant dehors à la tombée du jour, j'ai gardé la bouche trop fermée, je n'avais aucun mot à dire, mon expérience était limitée, rien n'était pareil, tu as tout dit tandis que je me cachais de celui qui était le père de ton enfant. Tu as sans doute pensé que non mais je t'ai entendue, tu as dit que l'amour n'est qu'un mot de quatre-lettre
* [M'abandonne pas|http://www.paroles.net/chansons/26220.htm](Les Rita Mitsuko)
* Maintenant que la jeunesse (Aragon/ferré chantée par Monique Morelli)
* Mathias (Gribouille/JM Bourgeois) chantée par Gribouille
* Maxie, Madge, et parfois Dicky Wagner (David Mac Neil)
* [Me and Bobby Mc Gee|http://www.youtube.com/watch?v=WISX2oSExIA] (de Kris Kristofferson et Fred Foster, interprété notamment par Janis Joplin et Gordon Lightfoot)
* [La môme kaleidoscope|http://www.paroles.net/texte/18503] (Hubert-Félix Thièfaine)
* [Mon amie la rose|http://www.paroles.net/texte/18522/artis/1877] (Caulier-Lacombe, chantée par Françoise Hardy, Natasha Saint-Pier, etc.)
*[Mon vieux|http://www.paroles.net/chansons/18650.htm] (Daniel Guichard)
* Les mots bleus|http://www.paroles.net/chansons/18782.htm]
**%%Blue(Je lui dirai les mots bleus/Les mots qu'on dit avec les yeux/Parler me semble ridicule/Je m'élance et puis je recule/Devant une phrase inutile/Qui briserait l'instant fragile/D'une rencontre/D'une rencontre)%%
* [Nantes|http://www.paroles.net/chansons/18902.htm] (Barbara)
* [Natacha|http://www.paroles.net/chansons/18910.htm] (François Béranger)
**%%Blue(''Ne me quitte pas, Je ne vais plus pleurer Je ne vais plus parler Je me cacherai là A te regarder Danser et sourire Et à t'écouter Chanter et puis rire)%%
* [La nuit je mens|http://www.paroles.net/alain-bashung/paroles-la-nuit-je-mens] d'Alain Bashung
* [La Noyée|http://www.paroles.net/texte/19164] (Serge Gainsbourg)
*** (chantée par Kathleen Ferrier, c'est sublime...)
*** ne continue pas à pleurer, à parler à un étranger, à énumérer les malheurs que tu as vus, trop de mauvais moments, trop de tristes moments, personne ne sait ce que tu veux dire
*** Je regarde en moi-même et vois mon coeur en noir / Je vois ma porte rouge et on l'a peinte en noir / Peut-être que je disparaîtrai pour ne pas faire face aux faits / Pas facile de faire face quand tout ton monde est noir...
* [Papillon du jour, toujours l'amour,Papillon du soir, toujours mouchoir.|http://www.paroles.net/chansons/33862.htm](Louis Chedid) -µµpourJLµµ-
* [Les paradis perdus|http://www.lacage.free.fr/Lyrics/32.txt] (Christophe)
** %%Blue(''Mais peut etre Un beau jour, voudras-tu Retrouver avec moi Les paradis perdus'')%%
* [Pauvre Rutebeuf|http://www.leoferre.de/texte/rutebeuf.html] (Rutebeuf - Léo Ferré, version par Joan Baez, et plein d'autres, texte du XIIIe s.)
* [Les Pêcheurs de Perles - (Je crois entendre encore...) |http://www.youtube.com/watch?v=U4DjTbYUcnA] (Bizet - chantée par Caruzo et d'excellents ténors)
* [Plaisir d'amour|http://www.youtube.com/watch?v=XdHoXRNdLKk] (notamment par Joan Baez)
* [Pouet pouet|http://www.france-jeunes.net/paroles/index.php?tid=MTI1MQ==] (Bourvil)
*** 'Le numéro neuf emprisonné déjà ils vont le confesser. il prie dans la cellule, avec le prêtre du pénitencier. Parce qu'avant de faire jour, la vie ils doivent lui enlever parce qu'il a tué sa femme et un ami déloyal. Il dit ainsi au confesseur : Je les ai tués, oui Monsieur. Et si je nais à nouveau je les tue à nouveau...
* Un Prince en Avignon (JM Rivat et JP Bourtayre, chantée par Ester Ofarim)
* Le prisonnier de la tour (écrite par Francis Blanche, chantée par Piaf et d'autres)
* [Quand la mer monte|http://users.skynet.be/fabicore/gd048301.htm] (Jean-Claude Darnal, chantée par Raoul de Godeswarsvelde)
**%%Blue(''Quand la mer monte/ J'ai honte, j'ai honte/ Quand elle descend/ Je l'attends/ A marée basse/ Elle est partie, hélas/ A marée haute/ Avec un au-autre'')%%
* [Que serais-je sans toi ?|http://www.paroles.net/chansons/20885.htm] (Jean Ferrat, poème d'Aragon)
** %%Blue(''Qui parle de bonheur a souvent les yeux tristes/N'est-ce pas un sanglot de la déconvenue/Une corde brisée aux doigts du guitariste/Et pourtant je vous dis que le bonheur existe/Ailleurs que dans le rêve ailleurs que dans les nues/Terre terre voici ses rades inconnues'')%%
**%%Blue(''Je mourrai dans une voiture carbonisée, la portière ne voudra pas s'ouvrir, et je hurlerai. Tu apprendras ma mort, atroce, par un ami, par les journaux ou par la poste, alors...'')%%
* [Richard|http://www.paroles.net/texte/21225] (Léo Ferré)
* [The Rose|http://www.skdesigns.com/internet/articles/lyrics/the_rose.html] (Amanda Mc Broom, chantée par Bette Midler dans The Rose)
* Ruby Don't Take Your Love to Town (écrit par Mel Tillis et rendue célèbre par Kenny Rogers)
*** Elle penche la tête et pleure sur ma chemise. Elle doit être blessée très sérieusement. Dis moi ce qui te rend triste LI ? Ouvre ta porte, ne te cache pas dans le noir, tu es perdue dans le noir, tu peux me croire, parce que tu sais comment cela doit être, Lisa, triste Lisa
*** partout où je vais, les gens que je connais disent que tu es de plus en plus fatigué de moi. dis que ce n'est pas vrai. (avec un solo de sax de son Jules... Ah!)
** %%Blue(''Your persian eyes sparkle, your lips - ruby blue -/never speak a sound/You, oh so g*ay, with parisian demands, you can run - around'')%%
**%%Blue(''Par les soirs bleus d'été, j'irai dans les sentiers,/Picoté par les blés, fouler l'herbe menue/Rêveur, j'en sentirai la fraîcheur à mes pieds./Je laisserai le vent baigner ma tête nue...'')%%
*[Septembre|http://www.paroles.net/chansons/31846.htm] : ''"j'y pense encore, j'y pense encore..."'' (Noir Désir) -µµµµpour VVµµµµ-
*** Bousculé et battu toujours un garçon seul, tu étais celui dont ils parlaient dans la ville alors qu'ils te tabassaient, et aussi dur qu'ils essayaient, ils te faisaient mal pour te faire pleurer, mais tu ne pleurais jamais devant eux, juste dans ton âme...
*** ''µµ??? Il semblerait qu'il y ait confusion entre "Sometimes I feel like a motherless child", vieux standard blues ( dont il existe notamment une superbe version par Ritchie Heavens à Woodstock) et "Summertime" de Gerschwin, version Janis Joplin entre autres interprètes... %%Red(oui c'est tout-à-fait vrai. Je découvre maintenant qu'il s'agit de deux textes différents, je pensais que c'était le même avec plusieurs versions - En fait il existe bien une version qui mélange ces deux chansons, interprétée par Mahalia Jackson)%%µµ''. Non, grosse erreur: Motherless Child est un Gospel traditionnel repris dans les fifties par Mahalia Jackson, et ça n'est pas un mélange mais l'origine!!
*** Suzanne t’emmène, à sa place près de la rivière, tu peux entendre les bateaux passer, tu peux passer la nuit près d’elle, et tu sais qu’elle est à moitié folle, mais c’est pourquoi tu veux rester là, et elle te nourrit de thé et d’oranges, venus tout droit de Chine, et quand tu veux lui dire, que tu n’as pas d’amour à lui donner, alors elle t’amènes sur son sillage et laisse la rivière répondre que tu l’as toujours aimée. Et tu veux voyager avec elle, et tu veux voyager en aveugle, et tu sais qu’elle te croiras, car tu as touché son corps parfait avec ton esprit.
* [Le Temps qui reste (récit)|http://www.paroles.net/chanson/47927.1] (Serge Reggiani)
* [La Tendresse|http://www.paroles.net/chansons/22482.htm] (Bourvil)
* [Tears in Heaven|http://www.youtube.com/watch?v=AscPOozwYA8&feature=related] d'Eric Clapton, chanson composée en mémoire de son fils Conor, mort brutalement le 20 mars 1991 à l'âge de 4 ans des suites d'une chute du 53e étage, par la fenêtre de l'appartement de Clapton.
**%%Blue(''Je serai triste comme un saule,/Quand le Dieu qui partout me suit,/Me dira, la main sur l épaule,/"Va-t en voir là-haut si j y suis."/Alors, du ciel et de la terre/Il me faudra faire mon deuil.../Est-il encore debout le chêne,/Ou le sapin de mon cerceuil ?'' ...)%%
*** Montre moi une prison, montre moi un cachot, montre moi un prisonnier dont la figure a pâli, et je te montrerai un jeune homme avec tant de raisons pour lesquelles il est là mais par hasard peuvent aller toi et moi
* To Daddy (Emmylou Harris, Dolly Parton)
**Maman n'a jamais paru manquer des plaisirs de la vie, ou si cela a été le cas, elle ne l'a jamais dit à papa... et un matin, nous nous sommes réveillés et nous avons juste trouvé un petit mot que maman avait écrit soigneusement à papa
* [Ton style|http://www.paroles.net/chansons/22654.htm] (Léo Ferré)
* [Villes natales et frenchitude|http://www.paroles.net/texte/23809] (sur l'album "Chroniques bluesymentales" de Hubert-Félix Thiéfaine)
**%%Blue(''Il dit - chérie tu ne recommenceras pas / Alors sans pitié froidement il l'étrangla / La vipèèère'')%%
*** Je sais, ça paraît peu, mais quand même, cette phrase... "''Je ne peux pas vivre avec ou sans toi''" Je trouve que ça ouvre un gouffre infini et oui, infini
/*2) c'est quoi cette mentalité de faire apparaître uniquement les commentaires positifs et de masquer les autres ? Si vous avez des problèmes d'égo, prenez un tic tac à la menthe ?
/* parce que ça abîme la liste, voilà pourquoi ! C'est une liste de chansons infiniment tristes et belles pas une liste de propos rabat-joie
voir aussi ListedeChansonsdAmour et ListeDeParolesDeChansonsDe et ListedExtraitsDeChansons
22/11/2013 - __Et sans surprise, parmi les 309 interprètes, auteurs ou compositeurs cités dans cette liste, on retrouve__
J. Higelin, Caruzo, Amanda Mc Broom, DAVMIC, Bobbie Gentry, Dicky Wagner, Jane Birkin, Madge, Boby Lapointe, Purcell, Jay Johanson, Spears, Anne Vanderlove, Dolly Parton, Jean Ferrat,
!!%%Center(Sponsorisé par)%%
ListeDePointsPourUneAssembleeGenerale
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*** Dans ce cas là on prend la partie entière E(x)
* Création du parti Echolo ?
** mes objectifs : + 100% par an
*** non, non, le gin & tonic a la priorité par ancienneté
ListeFantome
/*Par pitié ne hantez pas cette page avec de gros fantômes, merci !
%%Center(µµ''par ordre alphabétique''µµ)%%
* Cocktail fantôme : 1/5 d'alcool de poire, 4/5 de vin blanc d'alsace, une cuillère de crème fraîche, mélanger avec une cuiller à café, mettre un glaçon et ne servir que lorsque la crème s'est en partie redéposée à la surface, laissant dans le breuvage une traînée blanche et fantomatique... [http://abc.cocktail.free.fr/images/fantome.jpg]
* La Charrette fantôme, par Dali (c'est aussi un film de Victor Sjoström d'après Selma Lagerlöf : selon la légende, tout homme qui meurt en état de péché la nuit de la Saint-Sylvestre doit prendre la place du cocher et se retrouve condamné à l'[errance éternelle|ListeDeMaledictions].)
* "Les Revenentes" de Gerges Perec (une sorte d'antidote à ''La Disparition'')
* ventes aux enchères : Sur le site d'enchères de ebay, quelqu'un a mis aux enchères un "Fantôme irlandais véritable" enfermé dans une bouteille de 6 pouces de haut scellée par une page de la bible et de la cire. Mise à prix 5 livres sterling. Adjugé vendu pour 255 livres ! (oct 2004)[http://pagesperso-orange.fr/lemomo2/Irish_Ghost.jpg]
* Voir (apparaître) un fantôme
Et qu'alors, et parmi le lamentable émoi
µµHanté par Damien Pµµ
ListesDesPlaisirsGratuits
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Couper le son lors de la retransmission télévisée d'une manifestation sportive, de manière à pouvoir l'apprécier sans être pollué par les ânes de service (au hasard, Nelson Montfort, Gérard Holtz, Thierry Roland, etc.)
* Déguster un bon repas cuisiné par mon mari
* Dessiner des moustaches sur la statue de la Vierge et déclarer qu'après tout Marcel Duchamp avait fait pareil avec la Joconde
* Faire déplacer un plombier pour réparer un moulin à café, puis s'indigner de son incompétence s'il vous réclame le coût du déplacement.
* Inviter un imam à une saucisson-party
*** µµattention parfois, ils sont costauds… µµ
* Tamponner exprès une bonne sœur et s'excuser en disant : "Pardon madame, il n'était pas dans mes intentions d'entrer dans les ordres"
* Prendre un café dans un petit rade parisien à l'aurore avec une gazelle qu'on a connue la vieille (presque gratuit ! - enfin, si on ne compte ni le cinoche ni le restau de la vieille... ni la bouteille de wodka!)
* Se faire fouetter par une belle brune à lunettes très sévère (gratuitement ?) -- ben oui si c'est une bonne copine, elle peut faire ça gratuitement ! mais bon, c'est vrai qu'il faut trouver.
* Effacer quelque chose dans un wiki (parce que justement, si ça vous convient pas, on le déplace dans "ne convient pas")
ListedeSignatairesDeListes
/* par PITIÉ ne mettez pas de liens vers de GROSSES images. merci%%Center(__Liste de Signataires De Listes__)%%
* Jeg (voir la ListeDeListesLanceesParJeg)
** en parler à mme J.
*''"P. auteur de 2 listes virées du site pour trolLisme agravé (et on ne parle pas du reste !)"''... ..., dit le casse couilles, dit le trolleur, dit le communard
ListedAvisDiversParusAuJournalOfficiel
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Avis d'appel au mécénat d'entreprise pour l'acquisition par l'Etat d'un %%Red(trésor)%% national dans le cadre de l'article 238 bis 0 A du code général des impôts.
* Avis de rétrocession par l'Etat d'un trésor national au profit du Président de l'Association Echolalie
* %%Smiley(drink1)%%Association: %%Blue(__ASSOCIATION ECHOLALIE__)%%. No/Identifiant:%%%Activité(s): Culturel/Technique et Recherche %%Red(µµ__('tain ! Recherche !!)__µµ)%% %%%No de parution: 20030023 No d'annonce: 1679 __Paru le: 07/06/03__ %%%Département (Région): 75 - Paris (ILE-DE-FRANCE)%%% Sous-préfecture: Déclaration à la préfecture de police.%%% Type d'annonce: Création (déclaration d'association)%%%Déclaration à la préfecture de police. %%Blue(ASSOCIATION ECHOLALIE)%%.%%% Objet:%%Blue(__promouvoir un usage ludique, interactif et attractif de la langue française__)%% .%%Smiley(petard)%% via l'activité des sites www.echolalie.com, www.echolalie.org.%%% Siège social: 29/31, rue de l'Ermitage, 75020 Paris. Mél.: echolalie@echolalie.com.%%%Site Internet : www.echolalie.com.%%% Date de la déclaration : 24 avril 2003.%%Smiley(chinch)%%
ListeDesChangementsComportementauxDuPresidentDePuisSonElection
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Image(http://www.estesparklimo.com/images/whitelimo.jpg,300,128)%%
* Il parle de lui à la troisième personne
Proposée par F & A (µ''Le couple de l'année 1969''µ)
ListeDeNavions
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeComptesRendus
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Reçus établis par la Secrétaire. (en double exemplaire)
- Logo et modèle de carte à dessiner par le Conseiller artistique (pour action)
/* ah non, pitié! pas cette image !
- Réparation de la machine Echobot : Le conseiller technique, pour action.
- Engagement : 1 liste au moins par an (tous les membres, pour action)
- disparition d'Internet. (R. Moreno) : Le CA statuera
un grand merci à tous les participants.
ListeDesOeuvresDeJeanPierreBrisset
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* La Natation ou l'art de nager appris seul en moins d'une heure. Garnier frères, Paris, 1870 et M. Ch. Méra, à Lyon. 35 pages, 5 gravures. Il existe une édition de 1925 (collection Chambernac).
* Rééditions de l'édition française par le Cymbalum Pataphysicum en 1987 (Monitoires n° 6), préface de Marc Décimo,et en 1998 par les éditions du Paréiasaure Théromorphe . Réédition hors commerce en 1998 pour les étudiants de la section clinique d'Angers.
* La [grammaire logique|http://perso.wanadoo.fr/chambernac/grammaire1878.htm], ou théorie d'une nouvelle analyse mathématique résolvant les questions les plus difficiles. Chez l'auteur et à la librairie de J.-B. Fruchy, Leroy frères successeurs, 1878. 48 pages. Contient l'Aperçu du Maître de dictées, réédité en 2001 par les éditions du Paréiasaure Théromorphe à Poitiers, avec des illustrations de Quentin Faucompré. Réédition hors commerce en 1997 pour les étudiants de la section clinique d'Angers.
* La grammaire logique, résolvant toutes les difficultés et faisant connaître par l'analyse de la parole la formation des langues et celle du genre humain. Chez l'auteur et aux éditions Ernest Leroux, Paris, 1883. 176 pages. Réédition aux éditions Tchou en 1970 avec une préface de Michel Foucault. Réédition aux éditions Baudouin en 1980.
* La Grande Nouvelle. In-folio de 4 pages, éditions Chamuel, 1900. Réédité par le Cymbalum Pataphysicum en 1986 et pour les étudiants de la section clinique d'Angers en 1997 (hors commerce).
ListeDeRene
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDepaulesUn
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Ma fille a une luxure à l'épaule. ''Monsieur Dubois, parent d'élève''
* Une épaule dénudée et bronzée dans le métro parisien [http://sachatchenko.voila.net/2blondes.jpg]
ListeDeChosesAdireSurLeGolf
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Donne-moi des clubs de golf, de l'air frais et une jolie partenaire, et tu peux garder les clubs et l'air frais. ''Jack Benny''
* Le businessman américain est un monsieur qui, toute la matinée, parle de golf à son bureau et qui, le reste de la journée, discute affaires sur le terrain de golf. ''Jerry Lewis''
* Le golf, ce n'est guère autre chose qu'une façon coûteuse de se promener. ''Michaël Parkinson''
* Le golf est, pour ceux qui ont fait leur chemin, l'amusement d'accomplir encore un parcours. ''Albert Willemetz''
* J'ai une anglaise intérieur cuir, des costumes YSL, une femme qui suce, une prof de golf aussi, des amis à New-York, deux toiles de Gerhard Richter, des grands crus d'un peu partout, trente-huit balais, des agendas papier, des collègues casse-couilles et plein de trous à l'estomac.
* La crosse (tee) de golf a été inventée le 12 décembre par George F. Grant [http://www.echolalie.org/wiki/images/tee.gif]
* Les clubs de golf pour Gaucher ont été inventés par Harry Cover en 1937
* Pour tout joueur de golf, qu'il soit amateur, averti ou simple débutant, tout doit commencer par la maîtrise d'une bonne technique. ''(La Palisse ne mourra donc jamais)''
* Quand il pleut vous pouvez au choix, faire du golf d'appartement, vous masturber ou étrangler un hamster
* Savez-vous qu'Alan Shephard fut le premier homme à taper un coup de golf (un fer 6) sur la lune le 6 février 1971 au cours de la mission d'Apollo XIV ? Et que, en raison de l'absence d'atmosphère, on a jamais retrouvé la balle ?[http://www.spacedaily.com/images/moon-shepard-golf-bg.jpg]
# Vous devez avoir l'autorisation de la propriétaire du trou avant de jouer le parcours.
# Pour un jeu efficace le bâton devra avoir un manche ferme. La propriétaire du parcours se doit de vérifier la solidité du bâton avant que le jeu ne commence.
# La propriétaire du parcours se réserve le droit de limiter la longueur du bâton pour ne pas causer de dommages au trou.
# Le but du jeu est de donner autant de coups nécessaires et ce, jusqu'à ce que la propriétaire du parcours soit satisfaite et que le jeu soit complété. Tout manque à cette règle interdira le droit de jouer ce parcours à nouveau.
# Il est très mauvais goût de commencer à jouer le parcours immédiatement à son arrivée. Un joueur d'expérience prend normalement le temps d'admirer le parcours avec une attention toute particulière pour que les deux banquettes soient bien formées.
# Nous devons vous mettre en garde de ne jamais mentionner le fait que vous ayez pu jouer sur un parcours autre que celui sur lequel vous êtes en train de jouer. La propriétaire du parcours actuel pourrait en être bouleversée, et ainsi endommager l'équipement du joueur pour cette raison.
# Les joueurs doivent s'assurer que leur partie est bien planifiée, surtout quand le parcours est joué pour la première fois. Certains joueurs ont été très choqués d'apprendre que quelqu'un d'autre jouait sur un parcours qu'ils considéraient privé.
# Un joueur peut présumer que le parcours sera en bonne condition de jeu en tout temps. Certains pourraient être embarrassés de découvrir que le parcours est temporairement en réparation. On doit alors agir avec diplomatie dans pareil cas. Les joueurs plus expérimentés trouveront une solution de rechange pour contrer une telle situation.
# La propriétaire du parcours est responsable du soin et de l'entretien de tout buisson se trouvant autour du trou, afin de permettre une meilleure vision de l'alignement et de l'approche du trou.
ListeDeLaLiberteDeLaPresseClassementMondialDeuxMilleSix
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
*62 Chypre (partie Nord)
*82 Paraguay
#Cas de journalistes disparus (Oui/Non)
#Brouillage d’émissions audiovisuelles étrangères ou contrôle de l’installation de paraboles (Oui/Non)
#Existence d’un bureau officiel de censure préalable et systématique (tous les médias sont contrôlés avant de paraître) (Oui/Non)
#Régulation stricte de l’accès à la profession (diplôme ou formation obligatoire, appartenance exigée à un ordre des journalistes, etc.) (Oui/Non)
Reproduit par Tof le 18-10-2007
Oui mais surtout incomplet, et paradoxal au premier abord si on ne va pas lire [la méthode de calcul|http://www.rsf.org/IMG/pdf/methodo_francais_2007.pdf]
ListeDeNoeuds
/*Par pitié, éviter les gros nœuds, merci
* Un graphe fractal : tous les nœuds de degré 1 (les extrémités) sont remplacés par une copie du graphe, et ainsi de suite - Copyright G. Brougnard [http://www.echolalie.org/wiki/images/gfractal.jpg]
ListeDesLettresDeLalphabetUnPointCestTout
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
pangramme de GP dans la Disparition
ListeDeUneMauvaisePasse
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListeDeLegendesDeDessinsDeGlenBaxter
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# Julian’s exploits in the boudoir quickly became the talk of Paris
# this seemed to be the year when my parents and I would be enjoying our own separate holidays
# The conquest of the west – “such a breathtaking view” mused kit “there must be near enough parking spaces for 8000 000 vehicles”
# the months of rehearsal had paid off and at last I had become an integral part of the act
# The new accountant seemed determined to create a lasting impression on his first day with the partner ship
7. heureusement Robin était disponible pour assurer que mon nouvel uniforme d'école était une crise parfaite
15. après quelques mois que je se suis rendu compte cet étais simplement un appareil pour montrer me ces cuisses
17. Julian exploite dans le boudoir est devenu rapidement le discours de Paris
23. J'ai dépensé la plupart du weekend aidant Brian avec ses omelettes
24. Eric toujours a tenu à exécutant ses propres réparations
47. ceci a semblé être l'année quand mes parents et j'apprécierais nos propres vacances séparées
63. le nouveau service de buffet par-dessus à l'endroit de Howard prouvait peut-être pour être juste une ombre trop populaire
68. les mois de répétition avaient remboursé et enfin j'étais devenu une partie intégrale de l'acte
70. La premier entreprise de ted dans la sphère de réalisme magique apparu avoir reçu des revues mélangées
86. nous avons fait notre façon en haut par la fiction contemporaine et sur au cappuccino usine
91. Le nouveau comptable semblé a déterminé de créer une dernière impression sur le sien le premier jour avec le bateau de partenaire
ListeInternationale
/*Par pitié... on va faire attention, c'est promis !
* Version Rock par Biname /*lien mort
**µµun jour un mec m'a fait un salut... d'un commun, je ne vous en parle même pas...µµ
*Le grand parti des travailleurs ; ''Chauffe Arlette !''
*La terre n'appartient qu'aux hommes,
**''%%Green(pas de pitié pour les feignants, alors ?)%%''
*Un de ces matins disparaissent,
** µµnon, non il se dilatera en géante rouge comme les autres étoiles un de ces jours puis se ratatinera en naine rouge et finira par ne plus briller du tout ! Snif !
µµRévolutionnée par Jegµµ
ListeDesParvasDuMahabharata
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Complétée par la Liste Des Purvus Du Muhubhurutu :
ListeDeStatistiquesDeFrequentation
/* par PITIE ne mettez pas de liens vers de GROSSES statistiques. Merci
__ [2. Hit-parade|http://www.echolalie.org/wiki/index.php?ListeDeStatistiquesDeFrequentation#hitparad]__
En 2013, on constate une stagnation du nombre d’accès au site, avec une moyenne de moins de 4800 connexions par mois alors qu’elle était de plus de 7800 de 2010 à 2011, 9000 en mars 2007, et 18 999 connexions le 30 novembre 2011.
%%Mark(hitparad)%%
!Hit-parade
%%Center(%%Blue(__Et immuables au Hit-parade, 1££er££) ListeDePornoStar, %%%2££ème££) ListesDeNomsDeFilmsDeCulRigolos, %%%3££ème££) ListedemotscontenantaumoinsunefoischaqueVoyelle __)%%)%%
# ListeAnecdotiquesDesRuesDeParisOuDailleurs
# ListeDisparitionRevenentes
# ListeDeMotsRelatifsAlaPartiePosterieuredesHumains
[https://lh3.googleusercontent.com/-AxyqFfZJY7c/Us1Ot4ItGJI/AAAAAAAAGX8/UQpfn9_xQm0/w884-h725-no/hitparad.JPG]
Il ne parait pas anormal que le thème technicité soit commun à ces 4 listes moyennes
%%Center(####__Quelle bonne fée va parvenir à le sortir de sa looooonnnngue léthargie ?!!__####)%%
Pourtant, paradoxalement, le classement d'%%Red(__[Echolalie|http://mapage.noos.fr/echolalie/]__)%% sur [Estat| http://persos.estat.com/classement/audience/general/statistiques_1.html] est __en amélioration__ :
/*%%%et au blog de GB par le mot "__nekyopractie__
#####(µµ''Si vous aussi voulez voir figurer les stats de vos blogs dans ces statistiques, [faites les moi parvenir|mailto:solal_caro@yahoo.fr]''µµ) #####
%%Center(µµ__Nombre d’accès par mois pour créer une liste, un élément et une modification__µµ)%%
Au __31 décembre 2013__, __3202__ listes ont été créées dans Echolalistes, __62__ en 2013 soit __7% de plus__ qu’en 2012. Il se crée en moyenne __23__ listes par mois.
%%Center(µµ__Répartition des listes suivant le nombre de leurs éléments__µµ)%%
__10%__ des listes se partagent __la moitié__ des éléments, et __90%__ __l’autre moitié__.
%%Center(µµ__Répartition des listes suivant la longueur de leur nom__µµ)%%
Après __4251__ jours de fonctionnement, la moyenne de connexions par jour est de __5035__, il y a autant de jours comptant plus de __5328__ connexions que de jours en comptant moins. Le nombre le plus élevé de connexions a été __atteint le dimanche 30 novembre 2008__: __18 999__ !
[https://lh3.googleusercontent.com/-SqRCLjivFa8/Us1OyTfC-aI/AAAAAAAAGZg/o_DXs7zlcR8/w486-h339-no/repartfreq.JPG]
%%Center(µµ__répartition de jours suivant le nombre de connexions à Echolalistes__µµ)%%
#####''µ(Remarquez comme la répartition épouse intimement la courbe d’un polynôme de puissance 6 ?)µ :-P __µµcomme c'est troublant !µµ__''#####
%%Center(µµ__Répartition des accès suivant le nombre de listes__µµ)%%
Depuis avril 2012, on observe depuis, une __stagnation__ des accès. (__137 676__ connexions mensuelles et __4441__ par jour en décembre). La moyenne générale a légèrement diminué. Elle est de __152 065__ connexions mensuelles et __5 023__ par jour.
%%Center(__####''Et le listeur se reposa au septième jour de toute son œuvre, qu’il avait faite.%%%il bénit le septième jour, et il le sanctifia,%%%parce qu’en ce jour il se reposa de toute son œuvre qu’il avait créée en la faisant''####__.)%%
L'analyse du nombre moyen de connexions par jour de la semaine montre qu’il s’est stabilisé du lundi au vendredi et décroît toujours le week-end surtout __le samedi__ (__12%__ de moins que le __mercredi__). Et à l’inverse, c’est __ le dimanche__ le jour le moins propice à la création de liste __(442 en moyenne)__, soit __4%__ de moins que le jour faste, __le jeudi, (460 en moyenne)__.
%%Center(µµ__répartition du nombre de listes suivant le nombre de leurs modifications__µµ)%%
Une corrélation lie le nombre de modifications(__y__) d'une liste et son nombre d'éléments(__x__). Elle s’est __stabilisée (!!!)__ à une fonction linéaire d'équation __ y = 0,53x + 39,71__ %%Red(__('tain !!!!)__)%%. Tout se passe comme si, de manière paradoxale, une liste comptant __zéro__ élément a pu être modifiée __40__ fois %%Smiley(EEK)%% alors que la plus __grosse__ liste µ(ListedAsteroides)µ a été modifiée __523__ fois !!!
%%Center(µµ__Evolution du nombre de modifications par rapport à la taille des listes__µµ)%%
%%Center(µµ__Evolution de la taille des listes par rapport au nombre de connexions__µµ)%%
Enfin, il est également intéressant de constater que le nombre de connexions __y__ d'une liste peut être réduit à une fonction __stable (!!!)__ du nombre de ses modifications __x__ d’équation __y = 0,002x + 56,404__ alors que la taille de la liste concernée n'en est, elle, apparemment pas dépendante. %%Red(__Nooon ?__)%%
%%Center(µµ__Evolution du nombre de modifications et de la taille des listes par rapport au nombre de connexions__µµ)%%
Il n'est pas surprenant en examinant les thèmes des listes, de constater que les plus fréquents concernent la connaissance humaine, avant même ceux relatifs aux livres et à la linguistique, suivis de près par les loisirs et tout ce qui concerne Echolalie.
%%Center(µµ__Comparaison du nombre de listes suivant leur thème__µµ)%%
%%Blue(µµconçu et réalisé par Solµµ)%%
**la bonne question étant :"est-il raisonnable de tout traiter à partir de chiffres ?"
** ben si : les modifs peuvent avoir concerné des éléments (lignes) qui existaient déjà, juste en les corrigeant. C'est ce qui se passe souvent. A celà, il faut ajouter que ne sont pas comptabilisées dans le nombre d'éléments, les lignes qui ne commencent pas par astérique, donc à priori les commentaires, titres, etc.
* C'est possible de savoir combien de personnes ont créé des listes ? et le nombre moyen de listes créées par chacun ??? Merci très beaucoup - Kindofblue
***** Dans notre répuplique deliquescente des noms apparaissent dans des listings, et des lignes disparaissent dans les listes.
* C'est très instructif (et drôlement joli aussi), mais si je peux me permettre une requète, je n'arrive pas à lire les legendes du 2ème graphe de la partie Thème (un peu au dessus), pourriez vous l'agrandir un poil ? Ah oui, vous avez je crois oublié les ordonnées sur le 3ème graphe des Corrélations. Serait-il possible ?
ListedImages
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* image littéraire : Anthony Eden ressemblait à un parapluie.
* [Image disque|http://www.partition-saving.com/]
ListeDouble
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* La double contrainte paradoxale (double bind) : µµun bon lien est toujours préférable à un lourd copier/coller :-)µµ
* Double dâmes (c'est parfois la saison)
/*on ne va pas relancer une nouvelle polémique ! Ok ? -- On se demande encore qui a commencé . Censure un jour, censure toujours ! Et toujours quand je réponds, ce qui valide mon analyse. CQFD . Je rajouterai que les paragraphes sur les double-internautes etaient néanmoins intéressants et qu'un lien serait le bienvenu (en dehors de toute polémique!).---
* Double messieurs (c'est parfois la saison)
* Double mixte (c'est parfois la saison)
** ''"Mon ami, j'aime aller droit au but, et j'ai horreur des doubles sens - Parfait, nous disons donc : un modèle droit, non-réversible."'' (Greg, Achille Talon et le mystère de l'homme à deux têtes)
''µµ%%Blue(Evidemment c'est de voir la "liste simple" qui m'a donnée l'idée...%%%Liste créée par Kindofdouble (pardon - Kindofblue))%% %%Red( tiens ? y'avait longtemps qu'on t'avais pas vu toi !!! :-D tu vas bien ?)%%µµ'' Ouiii ! merci !!! juste quelques galères !
ListeDePlaquesCommemorativesParisiennes
/* par PITIE ne mettez pas de liens vers de GROSSES plaques. merci
!!%%Center(Liste de plaques commémoratives parisiennes)%%
PARIS :
**cette même plaque apparaît au 32, avenue du Dr Netier (12e)
* 7, rue Bonaparte (6e) :
* 19, rue Alexandre Parodi (10e) ou 25 rue Laugier (17e)
*Plaque gag posée rue St Denis et retirée par les services municipaux qui ne rigolent pas avec ses choses-là ![http://pagesperso-orange.fr/lemomo2/Carmen_com.jpg]
* Quelque part en Angleterre, une plaque commémore l'ancêtre des Chippendales [http://www.yorkshire-dales.com/chippendale-birthplace-03.jpg]
* [4 Rue Marie-Rose|ListeAnecdotiquesDesRuesDeParisOuDailleurs] (Paris XIV) avait vécu le camarade Vladimir Illich Oulianov dit Lénine (entre 1909 et 1912). Il y avait un musée dans son ex-appartement, fermé depuis. Il y avait également une plaque commémorative. Cette plaque commémorative a été enlevée lâchement par le conseil révisionniste des copropriétaires en 2007. Quelqu'un aurait-il une photo de la plaque ? µ(pas trouvé avec Gogol images...)µ.-- On s'en fout ! -- je ne vois pas ce que ça a de révisionniste, par contre la plaque foutait la honte...
*ListeAnecdotiquesDesRuesDeParisOuDailleurs
*ListeDeListesQuiParlentUnPeuDeParis
µµListe proposée par Gilles Rosière et complétée grâce à l'article de Jean-Pierre Le Goff dans "Viridis Candela", carnet trimestriel n° 12 du Collège de 'Pataphysique. Photos de Paris IVème communiquées par le [MAGICIEN|http://a.alafrez.free.fr/]µµ
ListePourAlleraTahiti
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* ''Allo ! Allo ! Merci de laisser les %%Red(__En__)%% et de ne pas les transformer en %%Red(__A__)%%, sinon ça va couper le charme de la liste, de toute façon quand je vais chercher ma baguette à Papeete je n'y vais pas %%Red(à)%% vélo mais %%Red(en)%% vélo, tout ça parce que j'aime bien embêter "les puristes"''
* En Apar
* En Moto (C'est exprés que j'ai laissé le "en" partout... d'ailleurs le "à moto" fait très archaïque voir(e) puriste)
* En Parachute ascensionnel
ListeDePersonnagesDeSigneFurax
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Maurice __Champot__, dit Maurice la Grammaire, descendant de l'illustre Champollion, patron du ''Bar de la Grimace'' à Tanger, alias Momo, alias le __Grand Babu__, enlevé à l'âge de 14 ans par les Babus, hypnotisé par les grands prêtres de la secte (''Maurice Biraud'')
* Théo __Courant__, alias M. X., ingénieur, inventeur du haut-parleur qui transmet à voix basse (''Xavier Gélin dans le film'')
* Sa Sérénité __Pauline__ IV puis V, Maharanée de Sama-Koutra, rebaptisé [Filékistan|ListeDePaysImaginairesDansLesLivresEtAuCinema] par les babus. Alias Mme Arnika. ''(Pauline Carton)''
* Le reporter Max __Blafard__, de Paris-Canaille, mort par pendaison
* Professeur Merry __Christmas__, membre de l'Académie des Sciences, barbu et titulaire de la chaire de barbologie descriptive à la Sorbonne dans ''Malheur aux barbus'', renommé __Hardy-Petit__ par la suite
* __Ducrouzeux__, employé délateur de la centrale de Morzy, descendu par Cocodou la Baya sur l'ordre de Furax
* __Euthymènes__, originaire de Palavas-les-Flots, ancien garçon de café, ancien inspecteur de la P.J., le plus mauvais policier de Paris, époux de Pauline IV (''François Chevais'')
* Mick __Flash__, photographe pour Paris-Canaille
* __Froutt__, parfumeur, créateur du sent-bon érotico-nocturne « Fufu »
* __Gergonsby__ Marcel, père de __Zippy__ Gergonsby, enlevé par les babus
* Anatole __Glouspic__, trésorier de l'A.A.A.A.A., Association Amicale des Anatoles Anciens et A venir, empoisonné au curare par une pantoufle piégée
* Commandant __Glusboc__, garde sur l'Atoll Anatole, remplacé par Théo Courant
* __Glusboc__, domestique du Pr Ebst, indigène de l'île d'Anjouan étripé par un homard géant
* __Gomez__, aide du Dr Ebst, dévoré par une araignée géante sur l'île de Karataka
* Les __GZBRHS__ : µµLe monde est menacé par de mystérieux envahisseurs venus d'une autre planète : les GZBRHS. Afin de conquérir la terre, ils se sont alliés aux ignobles Babus! Leur arme secrète est ''"Le gruyère qui tue"'' ! Celles et ceux qui le consomment deviennent des soumis dévoués à leur cause et qui disent "indibutablement" au lieu de "indubitablement", sauf les nuits de pleine lune entre 23 heures et 23 heures 05...µµ
* L'intransigeant brigadier Célestin __Jolipont__, ancien taxi parisien, douanier au Pakistan
* Ralph __Mac Intosh__, taxi parisien
* Le savant Grégory __Moshmosh__ , inventeur de la ''lumière qui éteint'' et de la coupole en cosmiglass (''interprété par le scientifique Jacques Bergier pendant quelques épisodes puis par Roger Carel'')[http://images.amazon.com/images/P/B0009F7FKO.08._SCMZZZZZZZ_.jpg]
* __Opoponax__, agent de police parisien
* Agnès __Paudemurge__, reporter au Soir de Paris
* Les __Pignoufs__, habitants d'Astérix. Se reproduisent par scissiparité.
* Julien __Pitoiseau__, mitraillé par les Babus
* Les __speakers__ des radios interprétés par ''Lawrence Riesner'' qui se rendra célèbre plus tard en faisant passer le permis de conduire à Jean Yanne dans un sketch célèbre.
*GKW __Van den Paraboum__, Adhémar de __la Cancoillote__, __Pâte-au-sabre__, __Ritou-les-Mains-Jointes__, Gédéon __Burnemauve__, Léopold __Lavolaille__, créés par Pierre Dac pour l'émission ''Le Club des loufoques'', 1937-1940.
* Révérend Père __Paudemurge__, Nicolas __Leroidec__, Adjudant __Tifrisse__, Colonel Hubert de __Guerlasse__, Professeur Slalom Jérémie __Ménerlache__, Jules et Raphaël __Fauderche__, __Zorbec le Gras__, Wilhelm __Fermtag__,Célestine __Troussecotte__ (secrétaire du colonel de Guerlasse)... créés, par Pierre Dac, Francis Blanche et Louis Rognoni pour ''Bons baisers de partout'', diffusé entre 1965 et 1974.
ListeDeMonstres
/* par PITIE ne mettez pas de liens vers de GROS monstres. merci
* L'Hydre de Lerne (tuée par Hercule)
* Le Monstre de Frankenstein (parce que Frankenstein c'est pas le monstre, c'est son créateur) [http://www.agirlsworld.com/amy/pajama/halloween/pix/bigfrank.gif]
* Zarak, le vilain catcheur masqué qui combattait l'Ange Blanc dans les matchs retransmis par l'Ortf et commentés par Roger Couderc (ça ne me rajeunit pas !)[http://www.movieposterclassics.com/images/bigZarak.jpg]
[la suite ici|http://www.paroles.net/chansons/15116.htm]
µµMG et reclassé par un autre MGµµ
ListeDeFilmsAyantPourTitreUnPrenom
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* __Baxter__ (1989) de Jérôme Boivin - µ(Baxter est un chien - le nom d'un chien s'apparente davantage à un prénom qu'à un nom de famille, non?...)µ
* __Christine__ (1958) de Pierre Gaspard-Huit
* __Evita__ (1996) de Alan Parker
* __Spartacus__ (1960) de Stanley Kubrick
* __Bunny__ Lake a disparu (1965) de Otto Preminger
* __Jane__ B. par __Agnès__ V. (1998) de Agnès Varda
* Depuis qu'__Otar__ est parti (2003) de Julie Bertucelli
%%Blue(µµListe créée par kindofblue... amitiés aux autres listeurs...µµ)%%
* L'Important d'être constant (2002) de Oliver Parker
* Cyrano de Bergerac (1990) de Jean-Paul Rappeaneau (avec Gérard Depardiou)
* Ainsi parlait __Zarathoustra__ µ(c'est pas un prénom, bande d'incultes!)%%Red ((mais c'est un wiki !!! ))%%µ
** par ailleurs, de quel film s'agit-il?...
ListeDeMotsCultes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* L'aménélectroreculpedalicoupeventombrosoparacloucycle[http://eurovelo6.e-monsite.com/medias/images/l-anemelectroreculpedalicoupeventombrosoparacloucycle.jpg]
%%Center(µµ[Librairie|ListeDePlaisirsDeLire ] Shakespeare & Co, Paris [Arnaud Frich| http://www.arnaudfrichphoto.com/shakespeare_1.htm]©µµ)%%
** [Disparition|ListedeslignesdAutobusparisiensayantdisparu]
** Séparation
%%Green(µµconsigné par solµµ)%%
ListeDeChosesEtDePersonnesQuiGonglentSurLeNet
/* par PITIE ne mettez pas de liens vers de GROS gonglages. merci
* Les doigts : Avec ses petits doigts gonglés par les ampoules
* Un imperméable qui marche : Ton imperméable ruisselant des gouttes de rosées marchait sans se presser gonglé par le vent.
* Les joueurs locaux : Gonglés à bloc par une séquence de six victoires consécutives,
* Le nez : En ce moment votre nez est encore gonglé par l'oedème
* La rivière : la rivière Petite Péribonka gonglée par la crue des eaux,
* La surface de l’épiderme : La surface de l'épiderme, échauffée par un frottement, gongle et forme une ...
* Toi : Tu es gonglé, de prendre le parti d'un multimillionnaire
* L'appareil : L'appareil gongle automatiquement la manchette
** On peut toutefois penser qu'au bout d'un moment, il aurait été repéré et indexé par Google, et serait rentré de ce fait dans cette liste par la grande porte... (cf liste de mises en abyme)
Liste participante à la ListeDeListesListantDesMotsIntrouvablesDansLesDictionnairesUsuels
µListe proposée par Gilles Rosièreµ
*µbravoooo Gilles !!! J'adore ! heu... t'as trouvé ça par hasard ou quoi ?µ
ListeDesDignitairesDeLaSecteDesCompagnonsDelAnus
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**L'Inébranlable Rempart de la Foi Rectale
**La Douce Préparatrice de la Voie Glorieuse
**9 Toujours par l'Anus tu défèqueras
**10 Toujours et partout tu sodomiseras la représentation du Seigneur ton Dieu
*Pas la peine de gémir pour obtenir un titre, la plupart sont déjà attribués
ListeDeTousLesDogmesDeLaFoi
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**Bien qu'invisible, la Licorne se manifeste physiquement à travers la disparition de chaussettes, qu'elle a l'habitude de « subtiliser ». La disparition d'une chaussette dans le panier à linge peut être considéré comme un « signe » de faveur de la Licorne Rose Invisible, ou bien de défaveur, ceci dépendant de la personne qui a perdu une chaussette, ou bien du type de chaussette ayant été « subtilisée ».
**De la même façon qu'il existe un diable dans certaines religions, la Licorne Rose Invisible a un Adversaire, l'Huître Violette. Il est dit que l'Huître Violette fut jadis un serviteur de la Licorne Rose Invisible, mais qu'elle fut chassée de Ses Pâturages et renvoyée vers le Mal Absolu, pour avoir essayé de persuader des fidèles du bien fondé de l'hérésie selon laquelle la Licorne préfèrerait la pizza champignons-poivrons à la pizza jambon-ananas. Il est également dit que le Jour du Jugement dernier, appelé le « Jour de l'Avoine et du Foin », l'Huître Violette sera pardonnée et retournera au service de la Licorne.
**Les licornes roses invisibles punissent les sceptiques en les piquant de leur corne. La douleur ressentie lors de cette punition étant la plupart du temps mise (à tort) sur le compte des moustiques, qui pourtant ne piquent pas les gens : ils ne piquent que les licornes, de la même manière que les taons ne piquent que les chevaux.
**Tous les signes suggérant la validité de la théorie de l'évolution de Darwin ont été placés par le Monstre en spaghettis volant afin de nous induire en erreur.
**Les prières adressées à Sa Nouilleté se terminent généralement par Ramen et le souhait à un autre pastafarien peut être adressé comme suit : « Puisse Son appendice nouillesque vous toucher » ou « Que la Pasta soit avec vous ».
**Le paradis promis à la fin de leurs jours contient pour les pastafariens un volcan de bière ainsi qu'une usine de strip-teasers/euses selon les goûts de chacun.
*** Nous déclarons, prononçons et définissons que la doctrine, qui tient que la bienheureuse Vierge Marie a été, au premier instant de sa conception par une grâce et une faveur singulière du Dieu tout-puissant, en vue des mérites de Jésus-Christ, Sauveur du genre humain, préservée intacte de toute souillure du péché originel, est une doctrine révélée de Dieu, et qu’ainsi elle doit être crue fermement, et constamment par tous les fidèles. C’est pourquoi, s’il en était, ce qu’à Dieu ne plaise, qui eussent la présomption d’avoir des sentiments contraires à ce que nous venons de définir, qu’ils sachent clairement qu’ils se condamnent eux-mêmes par leur propre jugement, qu’ils ont fait naufrage dans la foi et se sont séparés de l’unité de l’Eglise, et que de plus, par le fait même, ils encourent les peines portées par le droit s’ils osent manifester par parole, par écrit ou par quelques signes extérieurs, ce qu’ils pensent intérieurement. (Bulle Ineffabilis Deus)
***Au départ, il n'y a pas d'interdit spécifique concernant la représentation du Prophète. L'interdit de l'islam porte sur la figuration en général, sur les statues à fonction d'idole "inventées par Satan", comme dit le Coran, et présentées comme des "abominations". On sait que les monothéismes se sont constitués contre ce paganisme idolâtrique. Ensuite, on trouve dans la sunna ''ensemble des paroles et actions de Mahomet'', en particulier dans le recueil de hadiths "dits" de Muhammad al-Bukhari (810-870), que trois attitudes sont possibles envers l'image : tolérer, mais s'abstenir de la produire ; condamner par la parole ; pratiquer l'iconoclasme, c'est-à-dire la détruire. On ne peut pas produire d'image, car la fabrication de formes figuratives est considérée comme une activité menaçant le monopole créateur de Dieu. Du IXe au XIIIe siècle, les théologiens durciront ces positions.
***"Subiront le châtiment par le feu le plus terrible, le jour du Jugement dernier, tous ceux qui feront de la représentation figurée", écrit par exemple Muhammad al-Bukhari. Dieu les mettra au défi de créer une âme, soit une manière de rappeler qu'il a seul le monopole de la création complète, celle qui produit la matière, sa forme spatiale et l'âme qui doit nécessairement y être associée. Dieu reproche donc aux créateurs d'images de n'être pas des... dieux, c'est-à-dire de ne pouvoir donner une âme à une matière.
***__ Il rappelle qu'il est "faux et absurde" de dire que le Coran interdit la représentation du Prophète. Si Mahomet apparaît le plus souvent comme un prophète sans visage, cette règle a connu des exceptions. La polémique actuelle soulève la question de la figuration dans l'islam__
*Liste publiée par JPG avec le concours du [Magasin pittoresque|http://www.magasinpittoresque.be/pieuses/Images-pieuses.htm].
ListeDeParolesDeChirurgiensFacetieux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Personne n'a vu mon parapluie ?
ListeDeCommentairesOnLineDunePartiedEchecs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(__Liste de commentaires en ligne d'une partie d'échecs (kibbitz)__)%%
* [[15...De7] Bravant tous les interdits mollement posés par les Blancs, l'équipe d'ébène a tranché le nœud gordien. Dans une troublante gémellité, les cases f4 et f5 se répondent. Dans la tempête souterraine qui les anime, les Blancs envisagent-ils de poster un cavalier en f5, afin de profiter du vis-à-vis Tour-Dame ? Chaque tour est prête à prendre le relais de sa jumelle, et à se sacrifier sur les blancs remparts
* Dans un silence étourdissant, les pièces noires se mettent à parler et à se concerter : Et si tout ceci était vain ?
* [[30.Rh2] Fiers de leur avancée centrale, les blancs renâclent doucement, respirent calmement, insufflant un grand bol d'air vers leur Roi orgueilleux et blotti. S'affranchissant de toute contrainte, les blancs, tels un poète fou, font feu de tout bois, et parcourent l'échiquier de leurs dards vengeurs.
* Les pièces blanches vibrent à l'unisson et entonnent leur chant de guerre. Le poète souffre avec les blancs et arrose de ses larmes ce champ d'inutiles conquêtes. Surgissant des nuages, ovnis déconnectés, les troupes blanches volent à marche forcée vers l paradis de la huitième rangée. De toutes parts surgissent les fantassins fous, se sacrifiant, qui en g2, qui ailleurs, dans une mêlée désespérée de factice conquête. C4 martyrisé. c4 occupé, mais c4 libéré. Le modeste paysan fera-t-il le grand saut vers la plénitude exacerbée de la huitième rangée ?
* [[44.Da1] D'une gracieuse envolée, l'épouse royale de réfugie dans la cave, la case a1, d'où elle contemple d'une oreille sardonique les dommages infligés à la sombre armada. Epuisés et heureux, les deux amants se réfugient dans un sommeil réparateur, bercé de rêves de douceur. (partie nulle)
*µµPartie Fressinnet-Sokolov - 14 mars 2006µµ
ListeEnneigee
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# La neige en deuil [http://www.voirunfilm.com/includes/images/partenaires/jaquette/vuf/film/La+neige+en+deuil-49185.jpg]
ListeDesActionsMilitantesaLaporteeDeTous
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Aller à la manif, par principe, par habitude, par obédience... [http://nikosolo.voila.net/Roger_Hargreaves/mrmanif.jpg]
*S'acheter un duffel-coat dont on fera dépasser de la poche gauche un "Canard Enchaîné" tous les mercredi et s'abstenir de venir donner les cours parce qu'il y a une vague grève des trains qui n'affecte qu'une rame sur 6, trouver normal qu'on ne serve plus de porc à la cantine, puis faire signer des pétitions sur le manque de profs en prenant soin de caricaturer tout comportement contraire au sien.
** Variante : écouter en boucle "[Tout le monde ment, tout le monde ment|http://www.lesparoles.com/show-10620_Massilia+sound+system_Tout+le+monde+ment.html], le gouvernement ment énormément" des [Massilia Sound System|http://massilia.fiers-marseillais.com]. Chourmo !!
(Rapportée par CDD, merci Corinne !) µµ
* ne plus se raser tant que le gouvernement ne cède pas. Ainsi, si on est beaucoup, on verra apparaître une génération de profs hirsutes (et si le conflit dure longtemps, on aura de grandes barbes et on se reconnaîtra entre nous : "Ah ! Vous avez fait 2003, vous !")
*saboter le réseau informatique du bahut, bloquer GEP, envoyer des virus par mail à la secrétaire et proposer au principal "to enlarge his penis" __(Ah vous recevez aussi ces SPAMS-là vous ?)__ %%Red(µben non, pas moi, ils savent que jsuis déjà servi ;-)µ)%%
*écouter Thérèse "30 ans de carrière et pas une grève" vous parler de sa méga séquence sur l'engagement. Adopter l'attitude de Couve de Murville devant Mitterrand. µµc'est-à-dire ?µµ.
*dès que vous entendez Thérèse"30 ans de carrière et pas une grève" introduire les mots "solidarité", "citoyenneté", "engagement", "lutte", "égalité" dans son discours, faire comme si vous n'aviez pas compris. Prendre un air interloqué et selon votre style ou vos envies, dire "hein ?", "quoi ?" "pardon?", "plaît-il ?" (méthode authentiquement éprouvée à l'armée et grâce à laquelle j'ai pu être réformé)
ListeDeSavezVousQue
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Savez-vous que le logo de Chupa Chups a été créé par Salvador Dali en 1969. Chupa signifie sucer et Chups évoque le bruit de la sucette sortant de la bouche.
* Savez-vous que Guy de Maupassant et Charles Gounod figuraient parmi les 300 pétitionnaires qui protestèrent contre l'érection de la Tour Eiffel.
* Savez-vous que le branle coupé est une famille de branles décrite par Thoinot Arbeau dans son Orchésographie datée de 1589 ?
* Savez-vous que le sirtaki n'a jamais été une danse traditionnelle grecque, et qu'il fut inventé pour les besoins du film Zorba le Grec par Mikis Theodorakis en 1964.
* Savez-vous qu'Eva Joly est cousine par alliance de Sylvie Joly ?
* Savez-vous que les dernières paroles d'Einstein demeurent à jamais inconnues, car il les prononça dans sa langue natale, l'allemand, et l'infirmière qui veillait sur lui ne les comprit pas ?
* Savez-vous que l'île de Manhattan à été découverte un 11 septembre (en 1609 par Henry Hudson) ?
* Savez-vous que le docteur Kellogg (1852-1943) considérait que l'alimentation trop riche provoquait une trop grande excitation sexuelle, et que c'est pour cette raison qu'il a inventé les corn-flakes. Ce médecin était un partisan des méthodes extrêmes contre la masturbation : circoncision sans anesthésie pour les garçons afin que la douleur serve de leçon, acide carbonique (phénol) appliqué sur le clitoris pour calmer l'excitation des jeunes filles.
* Savez-vous que des trafiquants chinois sans scrupules commercialiseraient de la fausse ''[merde d'artiste|http://fr.wikipedia.org/wiki/Merda_d%27artista]'' -- µµsoyez prudents, ne mangez que de la vraie, dûment authentifiée par Maître [Tajan|http://www.tajan.com/]µµ
* Savez-vous qu'il existe un parti politique au Canada qui se réclame du rhinocéros, d’abord à cause de la forme (phallique) de sa corne, ensuite à cause de Ionesco. Ce parti (Néorhino) veut déclarer la guerre à la Chine, coupable de transformer les rhinocéros en aphrodisiaque.[http://pagesperso-orange.fr/lemomo2/Surf/rhino.gif]
* Savez-vous que le "tube" de Noël "Minuit-Chrétien" composé en 1847 le fut par Adolphe Adam qui était un athée convaincu ?
* Savez-vous que les baleines ont un petit à la fois ? A sa naissance, le baleineau mesure 6 mètres et pèse 6 tonnes. Allaité pendant 7 mois par sa mère, il grossit de 100 kg par jour pendant cette période --µµEnfin, ça dépend de l'espèce de baleine, non? -- car quand ça dépend, ça dépasse !µµ
* Savez-vous que John C. Woods, exécuteur officiel de l'armée américaine pendant la Seconde Guerre mondiale, périt par accident le 17 septembre 1950 alors qu'il dépannait une chaise électrique ?
*Savez-vous qu'en 1982, lors de la sortie du film "Le père Noël est une ordure", la RATP et la ville de Paris refusèrent de louer des panneaux pour l'affiche du film.... à cause de son titre !
***Et savez-vous que Alan Shepard fut le premier homme à taper un coup de golf (un fer 6) sur la lune le 6 février 1971 au cours de la mission d'Apollo XIV ? Et que, en raison de l'absence d'atmosphère, on n'a jamais retrouvé la balle ?
* Savez-vous que les cendres retrouvées dans le jardin de la villa louée par Landru à Gambais furent inhumées au pied d'un saule pleureur du Jardin des Plantes de Paris ?
* Savez-vous que le grand vizir de Perse, Abdul Kassem Ismail, qui vivait au Xe siècle, avait une bibliothèque de 117 000 volumes, et comme il ne voulait pas s’en séparer quand il voyageait, il la faisait transporter par une caravane de 400 chameaux à qui il avait appris à marcher dans l’ordre alphabétique.µµ(''Alberto Manguel Une histoire de la lecture'')µµ
* Savez-vous qu'en 1864, la moitié des départements français de la métropole étaient officiellement classés comme "ne parlant pas français" ?
* Savez-vous que le nouveau record du monde de Rubik's Cube est de 12 secondes (11 secondes et 13 centièmes exactement-- par Leyan Lo en janvier 2006) ! Étonnant, non ?
*Savez vous que écholalie est corrigé en ectoblaste par le correcteur de certaines versions de Word
*Savez-vous que si vous regardez bien fixement le feu dans la cheminée, il finit par s'éteindre (source : Jean-Michel Ribes, Merci Bernard)
** Et que le roi George III d'Angleterre pissait bleu ? ''µparce qu'il se soignait au bleu de méthylène !µ'' --µµnon. Parce qu'il était malade, atteint sans doute de porphyrie. Il est mort fou, aveugle et sourd en 1820. µµ--
*Savez-vous que le corps humain produit environ un demi-litre de gaz par jour évacué en moyenne au cours de 14 pets
* Savez-vous que la plupart des " rouges à lèvres " contiennent des écailles de poisson ?
* Savez-vous que Georges Pérec a publié en 1972 un roman "pornographique" intitulé "les revenentes" (non il n'y a pas de fautes) avec comme contrainte l'interdiction d'employer d'autre voyelles que le "e" : facile avec les sexes, membres, fesses, lèvres ou levrette. Mais moins convaincant avec les qeqettes, le Q, le glend, les testEeQles, bézer leebrement, enfeeler, bende d'enQlés, en sendweech, etc. A lire pour une incroyable scène de partouze chez un évêque.
* Savez-vous que des millions d'arbres sont plantés par accident par les [écureuils|ListeDecureuils], en enterrant des graines et en oubliant où ils les ont mis ? [http://www.pc.gc.ca/pn-np/inc/PM-MP/images/ecureuil-roux-red-squirrel-knp-cd1544-27.jpg]
* Savez-vous que si vous farinez une côte de porc avant de la cuire, elle sera particulièrement moelleuse. ...
* Savez-vous que vous avez plus de chances d'être tué par un bouchon de champagne que par une araignée venimeuse.
* Savez-vous qu'en France, les accidents domestiques provoquent à peu près trois fois plus de victimes que les accidents de la route ? (environ 20.000 décès par an)
* Saviez vous que Judy Holliday s'est fait allumer par le FBI en 1945 parce qu'elle avait organisé un spectacle au Carnegie Hall au profit des orphelins de Stalingrad. C'était une activité anti-américaine... [http://2.bp.blogspot.com/_dXvGSWAPHOE/SpjBV9MMeHI/AAAAAAAAA4Q/poaCKvYURuk/s320/JudyHolliday.jpg]
*Savez-vous qu'en l'an 1000, on déterra le corps de Charlemagne parce qu’une légende disait qu'''un Empereur se lèverait de son sommeil pour combattre l’antéchrist.''
*Savez-vous que sur le site d'enchères de ebay quelqu'un a mis aux enchères un "Fantôme irlandais véritable" enfermé dans une bouteille de 6 pouces de haut scellée par une page de la bible et de la cire. Mise à prix 5 livres sterling. Adjugé vendu pour 255 livres ! (octobre 2004)[http://pagesperso-orange.fr/lemomo2/Irish_Ghost.jpg]
*Savez-vous que c'est par dérision qu'en 1922 Léon Bel a baptisé son invention Vache-qui-rit d'après le mot allemand Walkyrie [http://fr.wilogo.com/themes/wilogo/images/upload/2009/05/vache2009.jpg]
** Savez-vous pourquoi la Vache qui rit rit ? - Parce qu'elle a été dessinée par Benjamin Rabier qui n'a jamais su dessiner les animaux autrement que rigolards. Cf.les Fables de La Fontaine, illustrées par B. Rabier)
** Mais qu'il existe des noms de villes encore plus longs, notamment Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu qui se trouve en Nouvelle Zélande; et Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit qui se trouve en Thaïlande. Vérifiez par vous même [ici|http://www.llanfair.com/]
* Savez-vous que chaque être humain (ex : Antoinette, moi, vous, Ornella..) produit chaque jour 340 millions de [neutrinos|ListeDeNeutrinos] qui partent aux confins de l'univers à une vitesse proche de celle de la lumière ?
**ce qui fait 4000 neutrinos par seconde !
* Savez-vous que dans le temple d'Angkor-Vat, il existe une pièce nommée Echo-Room"? - vérifié et constaté de source sure par GB, conservateur de musée cambodgien et [reporter|http://www.echolalie.org/gdb] -
* Savez-vous que la Sainte Vierge (tm) est apparue 437,63 fois sur Internet depuis le 1er août 2003 ? µµsource ?µµ
* Savez-vous que 'Essaouira' veut dire 'La bien dessinée' ? (par l'architecte Théodore Cornu)
* Savez-vous que la Picardie produit chaque année 2300 hectolitres de vin AOC ?**(sans doute du... Champagne! le sud de l'Aisne département administrativement picard, étant historiquement champenois)
* Savez-vous que la réalité est parfois trompeuse ?
**µµfaudra nous expliquer parce que dire sans autre précision que deux choses sont alignées, c'est exprimer une évidence. - et pourquoi placer cette "contribution" en plein milieu ?µµ
* Saviez-vous que, au mépris des règles supposées par beaucoup, on écrit "vraisemblable" et qu'on le prononce comme "vraiSSemblable" ?
* Savez-vous que le président Chirac s'est vanté publiquement de pouvoir se toucher une [burne|http://240plan.ovh.net/~echolali/wiki/index.php?ListeDeBurnes] sans faire bouger l'autre ? -µµ plus exactement, il a dit - en parlant d'une déclaration jugée sans importance de Mme Thatcher: 'ça m'en touche une sans faire bouger l'autre - il fallait le dire'µµ
* Savez-vous que Dieu est [apparu|ListeDeMiracles] __49__ fois à [Dozulé|http://www.prevensectes.com/dozule.htm] (Calvados) ?
* Savez-vous que les machines à laver dépareillent les chaussettes ? µµc'est ben vrai, ça !!µµ
* Savez-vous que le plan du premier ordinateur a été conçu par [Ada|http://www.internenettes.fr/femme/ada.html] Lovelace, la fille unique de Lord Byron ? -%% LInda ? µµ
* Savez-vous que le [téléphone|ListeDuTelephone] portable a été lui aussi inventé par une femme : Hedy Lamarr ?
** Savez-vous qu'elle eut [six maris|ListeDeMarieesEtMariesMultiplesVoireCompulsifs] (séquentiellement) et parlait au moins autant de langues ?
* Savez-vous que quand Carrie Fisher, la princesse Leia dans Star Wars a appris qu'on l'avait volontairement sélectionné au casting à cause de son look non sexy, elle s'est vengée après le succès du film en n'allant aux réceptions hollywoodiennes qu'en robes "très" transparentes... [http://aldo063.free.fr/31%20octobre%202003/carrie%20fischer/pic031021-01022.jpg]
* Savez-vous que Betty Page, LA pin-up par excellence, a fini dans un couvent? -µµnon, c'est inexact et bien plus compliqué que ça...µµ bah alors quoi, personne se dévoue pour mettre une jOOlie image ? - moi je trouve qu'elle ressemble à [Antoinette|http://www.echolalie.com/feuille.htm]µµ
** tiens ! je croyais qu'elle avait disparue du jour au lendemain !?
* Savez-vous que vous dépensez 150 calories par heure en vous cognant la tête sur un mur ? (Je n'en reviens toujours pas pour le cochon.)
* Savez-vous que certains lions s'accouplent 50 fois par jour ? (Dans ma prochaine vie, je veux toujours être un cochon ...la qualité est mieux que la quantité!) ''(et si on crée un lion génétiquement modifié à partir d'un cochon, il pourra avoir un orgasme de 25 heures par jour)''
* Savez-vous que l'urine de chat brille sous une " blacklight " ? µ (ça fait très bonne impression dans un repas de famille, en fait elle est fluo)µ µµ- S'agit-il des rayons émis par la lampe de Wood ?µµ
* Savez-vous que le citoyen Palloy, qui a démoli la Bastille, vendit une partie des pierres et avec les autres construisit une autre prison ?
* Savez-vous que le premier homme créé par Dieu portait des lunettes ? ... et avait une toute 'tite bite ? C'est parce que la photo a été prise avant l'invention de la femme
* Savez-vous qu'il n'existe pas de prix Nobel de mathématiques parce que la femme d'Alfred Nobel, fondateur posthume du prix, le trompait avec un jeune mathématicien plein d'avenir nommé Gosta Mittag-Lefler ?
* Savez-vous que les plus anciens noms de Parisiens qui nous soient parvenus sont Ermenfroi, Hervé, Herland, Ouacre, Brougnard, Hervi, Arnoud, Seuil, Joubert, Gui, Hardré, Aimard et Gossouin (morts en février 886 contre l'assaut de la tour du petit Châtelet par les vikings et commémorés par une plaque située dans la crypte de Notre-Dame) ?
* Savez vous que par superstition, les portugaises ne se rasent pas sous les échelles.
* Savez vous que l'odeur des aisselles est provoqué par une bactérie. -- ce ne serait pas des phéromones plutôt ?
* Savez-vous que si les planètes avaient une influence sur notre comportement (bases de l'astrologie) par les rayonnements qu'elles émettent, alors un micro-onde influerait cent fois plus alors sur nous ? -- µµavec des si...µµ
* Savez-vous que l'animal le plus souvent vu par des personnes atteintes de NDE (expérience de la proximité de la mort) est un chien, noir ou gris selon les témoignages ?
**Parce que la question est récurrente ! Au fait avez-vous essayé ?
ListeDeBouts
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Il y a des femmes qui sont comme le bâton enduit de confiture de roses : on ne sait pas par quel bout les prendre. ''Alphonse Allais''
* Les feuilletons doivent être lus par petits bouts, aux cabinets. ''Jules Renard''
* Quand la tour de Pise penche vers la droite, c'est qu'il va pleuvoir. Quand elle penche vers la gauche, c'est que vous arrivez par l'autre bout de la rue. ''François Cavanna''
* J'ai passé un %%Red(bon petit bout de temps)%% à réparer cette %%Red(@*¤%£&###@)%% de liste
[http://www.pochesmarket.com/poche_prod/images/partylinks.jpg]
* Un bout de papier indiquait simplement qu'elle était partie...
* [Hot-Dog|ListeDeSaucisses] : Bout de Pain tranché dans lequel on a fait cuire une saucisse de Strasbourg ou une saucisse de Frankfort (laquelle est rouge, laquelle est orange ?) avec un peu de gruyère. On rajoute à la fin de la moutarde ou d'autres bêtises. Est parfois d'une consommation agréable quand le pain n'a pas été trop cuit, sinon c'est dégueu.
* Par le petit bout, par le petit bout, par le petit bout de la lorgnette...
* [Brûler la chandelle par les deux bouts|ListeDesExpressionsPopulairesContenantLeNomDunObjetUsuel]
* Se faire mener par le bout du nez !
* Melon et Melèche se partagent un sandwich : Melon prend le début et Melèche le bout.
__A savoir__ : cette liste a existé, crée le 11 janvier 2003 elle a subit plusieurs modifications (60), enrichissements et illustrations. Le 25 janvier 2005, un imbécile a détruit cette liste deux fois de suite. Le même jour une liste baptisé liste anti spam subissait le même sort. Seule alors l'admininistration de ce site pouvait les restaurer, ils ne l'ont pas fait et ne se sont pas exprimés sur le sujet. (Une troisiéme liste, à vocation - disons plus liciencieuse - subit régulièrement les mêmes attaques. Mais a semble-t-il été sauvegardée par un internaute.)
__A savoir__ : ce ne sont plus des imbéciles(si, si, quelquefois) qui détruisent les listes mais des spammeurs (robots?) colombiens, russes, ou chinois. L'administration s'exprime : elle a bloqué les IP. Mais il y en aura d'autres. Difficile de surveiller en permanence 1600+ listes. Ecrivez si PB urgent ([LW|mailto:echolalie@echolalie.com]). Voilà. Il y a des sauvegardes. Mais si quelqu'un aime bien sa liste, pas interdit de la sauvegarder chez soi, par copier/coller du texte édité. Et puis on a eu des problèmes à l'Equipe Technique. Deux ingénieurs ont été licenciés pour faute grave (harcèlement). La dernière recrue ([EPF|http://path.berkeley.edu/~bougler/epf/class94.html], promotion 1994) semble faire l'affaire. Mais elle n'est pas encore rodée. -- (débridée ?) -- tsssssss
ListeDeJuin
/* par PITIE ne mettez pas de liens vers de GROS joints. merci
* Le mois de Juin dans les villes est toujours le plus bordélique, il y a des travaux partout qu'on se dépêche de finir (de bâcler) avant l'arrivée des touristes et avant les vacances des ouvriers. Profitant du laxisme ambiant, le [concombre masqué|ListeDuConcombreMasque] en profite pour aller regarder tout ça de plus près... Il est temps de faire quelque chose ! [http://www.leconcombre.com/travail/img/concombre-travail.JPG]
* [7 juin 2003|http://240plan.ovh.net/~echolali/wiki/index.php?ListedAvisDiversParusAuJournalOfficiel]
**39eme minute : Coup franc joué par Beckham côté droit en retrait de la surface. Ballon travaillé que Lampard reprend victorieusement de la tête aux six mètres. But ! 0-1
**73eme minute : Silvestre fauche Rooney dans la surface. Pénalty tiré côté gauche du but par Beckham mais repoussé par Barthez. (1er miracle, le score n’est pas 0-2)[http://www.drole.ch/img/98569373.jpg]
**91eme minute : Coup franc à 23 mètres que Zidane place hors de portée du gardien anglais (1-1) 2ème miracle. Le match se terminera donc par un nul... non car...
**93eme minute : Peu après la remise en jeu, Gerrard remet en retrait à son gardien mais Thierry Henry s’interpose et se présente face à James qui le fauche dans la surface. Pénalty transformé par Zidane. (2-1) 3ème miracle. La France est qualifiée et seule en tête de son groupe.
***''Ce fut le soir des 3 miracles. On connaît hélas la suite, la France éliminée par la Grèce qui gagna la coupe...''
* 21 juin 1994 : Près de Getafe, en Espagne, une météorite de 12 cm de large et de 1,4 kg traverse le pare-brise d'un véhicule, plie le volant et casse le doigt du conducteur. Plus de 50 kg de météorites sont retrouvés à moins de 200 mètres de l'accident
* le 30 juin 1908 : Une météorite explose 8 000 mètres au-dessus de la région de Toungouska en Sibérie centrale. L'onde de choc, comparable à 1 000 bombes d'Hiroshima, ravage 2 000 km² de taïga (forêt de conifères). Les jours précédents, le ciel nocturne était devenu de plus en plus clair et, dans la nuit du 30 juin, de gigantesques flashes étaient apparus
** L'antenne parabolique : inventée le 07 juin 1887 par Granville T. Woods
** Le piano mécanique : inventé le 11 juin 1912 par Joseph H. Dickinson
** La machine à composter : inventée le 22 juin 1897 par William Barry
** Le balai-laveur : inventé le 13 juin 1893 par Thomas W.Steward
** Le système d'alarme des trains : inventé le 15 juin 1897 par Richard A. Butler
** Le sèche-linge : inventé le 07 juin 1892 par George T. Sampson
** La peinture et les colorants : inventés le 14 juin 1927 par George Washington Carver
** Le landau (poussette) : inventé le 18 juin 1889 par William H. Richardson
** La moissonneuse : inventée le 03 juin 1890 par H.L. Jones
** La ramasseuse de coton : inventée le 05 juin 1894 par Georges W. Murray
** L'antenne de détection par radars : inventée le 11 juin 1968 par James E. Lewis
** La cellule électrique gamma : inventée le 06 juin 1971 par Henry T. Sampson
** Le filament de carbone : pour la lampe à incandescence : inventé le 17 juin 1882 par Lewis Howard Latimer
* [La fille du coupeur de joints|http://www.paroles.net/texte/15073]
ListeGaie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** ''Harmonie d'un soir à Chateaugay'' (par Beau Dommage)
* Je suis gai, je suis gai, soyons gais, soyons gais, et la la itou.. la itou (Chanson de Paris dans la Belle Hélène de Jacques Offenbach)
* Marvin Gaye µ(qui s'est fait refroidir par son père au cours d'une dispute familiale)µ
ListeDencheresInteressantes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**µµcommentaire de l'enchère : "Les illustrations de l'ouvrage ont été,en grande partie,empruntées aux collections personnelles d'André Breton qui furent dispersées il y a quelques mois,atteignant les sommets que l'on sait."µµ
µµenchères suivies par A. pour le Musée de l'[Ermitage| ListedeThemesRecurrentsSurEcholalieEtDansCeWiki] µµ
ListeDeCreationsEtDeDissolutions
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
No de parution: 20030023 No d'annonce: 5 Paru le: 07/06/03
partement (Région): 01 - Ain (RHONE-ALPES)
Objet : regrouper des jeunes pour promouvoir leur sens civique et leur esprit de dévouement ; assurer une formation civique et théorique enrichissante sur le plan personnel ; préparer, par des cours théoriques, des démonstrations pratiques et sportives, à la fonction de sapeur-pompier ; faciliter le recrutement ultérieur de sapeurs-pompiers volontaires ou professionnels.
No de parution: 20030023 No d'annonce: 6 Paru le: 07/06/03
partement (Région): 01 - Ain (RHONE-ALPES)
No de parution: 20030023 No d'annonce: 7 Paru le: 07/06/03
partement (Région): 01 - Ain (RHONE-ALPES)
No de parution: 20030023 No d'annonce: 1679 Paru le: 07/06/03
partement (Région): 75 - Paris (ILE-DE-FRANCE)
Siège social : 29/31, rue de l’Ermitage, 75020 Paris. Mél. : echolalie@echolalie.com.
No de parution: 20030023 No d'annonce: 8 Paru le: 07/06/03
partement (Région): 01 - Ain (RHONE-ALPES)
No de parution: 20030023 No d'annonce: 9 Paru le: 07/06/03
partement (Région): 01 - Ain (RHONE-ALPES)
Fait à Paris, le 21 avril 1997.%%%
%%Center(Par le Président de la République.)%%
µCommuniqué par Adèle W., préposée à la lecture du JOµ
ListDelafoliequisemparedesgensquidoivereviserleurbacetquisamusesurlessitesbizarres
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** µ''et pour finir, vot' bac, vous l'avez eu ? Ou pas ? Parce que vous ne m'avez pas l'air d'avoir traîné trop longtemps par ici ; trois p'tites lignes et puis s'en vont... Je vous vote la liste de rattrapage.''µ Toi l'ancétre, on t'as pas sonné.
*** µ''Ici, c'est MOI qui sonne... la date des exams, la fin de la récré et tous ces trucs du genre partiels ou bac blanc, alors l'ancètre n'est pas du tout prèt à s'écraser !''µ
ListeDeSujetsDuBac
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* On parle des années 60. Peut-on parler des trimestres 240 ?
* Un sujet de géométrie dans l'espace pour les S, non traité par les profs en grève, ni par les autres d'ailleurs !... -- µEn fait ça n'a rien à voir avec ce que nous - les anciens - appelions 'géométrie dans l'espace' (beurk). C'est plutôt un sujet sur les courbes paramétrées à 3 dimensions. Inutile d'être un visionnaire de l'espace pour le résoudre. Un peu de jugeotte ... -- %%Red(ça doit pas se résoudre avec les différentielles ça?)%% - Si, c'est tiré du problème [principal|http://www.maths-express.com/bac-exo/BAC-S/ProblemeS-S/national03/prob-national-s-03.pdf] µ
** - Ah non, pitié ! ce service est en grève (variante : vacances/Travaux/repos)µ
ListeDeFetiches
/*Par pitié pas de lien sur des gros fétiches, OK ?
* Fétichisme de la [chaussure|ListeDeGrolles] [http://radio-canada.ca/par4/images/marilyn_soulier.jpg]
* Fétichisme des membres amputées, ou par extension blessées. Certains demandent ainsi à leur partenaire de se plâtrer (ou de se bander) un bras, une main, un pied, une jambe, avant tout rapport..... (Acrotomophilie)
* Fétichisme du Paris St Germain [http://1.bp.blogspot.com/_Ltz622iKKyE/SJmPJMm1mDI/AAAAAAAAAFg/JDksvvADCug/s400/psg.gif]
* Fétichisme du plumeau (et en parallèle, phobie de la moindre poussière) -- Plumophilie ?
* Pieds de Trésorier. (Statuette naïve et emblématique, composée de cinq pieds de trésorier et de quinze clous, invoquée par les Echolaliens, les nuits de pleine lune, dans la chaleur lourde de l'été, quand l'appel des hormones se fait pressant. Les clous rappellent le martyre de on sait qui, et les pieds rappellent qu'il faut toujours se munir de bonnes chaussures quand on va faire du tourisme à Madrid. Guérit la frigidité, l'impuissance, et peut, parait-il, combler le trou de la Sécu.)
%%Center(µFétiche écholalien confectionné par Georges Brougnard (explorateur)µ)%%
ListeDeVagues
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* La neuvième vague, vue par l'immense Rick Griffin
* La vague par excellence, dessinée par Hokusaï[http://www.gomamago.com/Pix/hokwav.jpg]
** [Nouuuuvelle vague|http://pantin.boom.r&#117,/texts/a/anthony_richard/nouvellevague.htm] chantée par Richard Anthony
µµpar [Jesus II|mailto:christophe@lozere.org]µµ
ListeDeTout
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Tout commence et finit par un t
*Tout doit disparaître
***Parce que le tout c’est de 6 mètres...
*Par Toutatis
µµListe proposée par X suite à une idée qu’il a eue tout d’un coupµµ
ListedeSiglesetAcronymesDetournes
** Autorisation de Défoulement par Sexe en Ligne
** Appareil Génital Féminin
** Ad Nuncuam Prosperare Est µDevise des enfers, que l'on peut traduire par
*** µpitié pour les typographes !µ
** Complaisamment Noyé par les News
** C'est Parti les Emmerdes
** Foutaise Assistée par Ordinateur
** Fabrication Ordinaire Réparation Difficile
* [LISP|http://www.paulgraham.com/rootsoflisp.html] List of Insipid and Stupid Parenthesis µ- ah mon langage préféré !! - Je préfère quant à moi le loucherbem et le tagalog (de Manufrance)µ
** Même En Dormant, Enrichit ta Famille (µµGustave Parkingµµ)
** Métro Express Régional Défense Étoile µµ(véridique mais abandonné nom de la première ligne du RER parisien. Décidé par des ingénieurs ou des énarques, il fut dénoncé par le peintre chargé d'en peindre les lettres dans les stations.µµ
** [Occis Carton Blindé|http://www.paroles.net/chansons/25051.htm]
* OFNI Objet Flottant Non Identifié µ%%Green(- Quoique parfois...)%%µ
** Organisation de Partouses Andromimétophiles
**Parti Chier
**Parti des Cocus
** ''ou'' Parti Chercher Fernande '
** ''ou'' Parti des Cocus Fusillés '
** Particulièrement Difficile à Faire
** Parti de Rien
** Parti Sociétal
** Parti Ségoléniste
** Parti Sans Gagner
** Paris Sans Gagner
** Personnel Traumatisé par le Travail
** Reste Avec Tes Parents
** Ramification Absolument Transcendante et Parvenue
** Riz Aphoniquement Thérapeutique et Parisien
** Rupture d'Anévrisme Transport Paralysé
** Racaille Parisienne Recyclée
** Repaire de Pourris Parisiens
** Sonorité Nouvelle de la Cornemuse Finistérienne (envoyé par cheminot nantais)
** Travesti en Vêtement d'Apparat
** Un Coup Par An - µOuah, génial ! - Ca c'est le point de vue des stagiaires, mais du point de vue des moniteurs c'est "Un Coup Par Arrivage"µ
*** (µcelle sud-africaine, la précédente, d'après son descriptif, semble plutôt désigner le parti de Raymond Barreµ)
** Une Démonstration Foireuse (rappelez-vous Jérôme Bonaldi à Nulle Part Ailleurs sur Canal+)
** Un Mauvais Pari
** Union du Maquereau de Paris µ(tag vu dans une cabine urinatoire et/ou défécatoire)
** Urgences Médicales de Paris
** et Finalement : Un Mauvais Parti !
** Urine Remboursée par la Sécurité Sociale
*Ce [site, www.acronymfinder.com|http://www.acronymfinder.com] recense les acronymes. %%%Avec parfois des énormités qui passent au travers des vérificateurs (ex. de SNCF : Savoir Nager Comme Fernandel :-))-- remplacé par Sans Nous les Cafés Ferment!--/* J.
Liste initialisée par Samosse 51 (tm) µ- de mon temps, c'était 99... ??µ
ListeDeFreresEtDeSoeurs
! /* par PITIE ne mettez pas de liens vers de GROSSES fratries. merci
*µµNote à "moi je": et on fait comment pour le deviner quand c'est pas marqué, et est-ce que c'est une façon de parler aux autres?µµ
* Les frères André (1909-1973) et Léon (1906-1969) __[Barsacq|ListeDeNomsPropresEtCommunsSeTerminantParUnQq]__, décorateurs - André fut aussi metteur en scène et directeur de théà¢tre
* Les Frères __Blanc__, restaurateurs a Paris,
* Les frères __Bonaparte__
* Charlemagne et Gisèle ''(ils eurent d'ailleurs un enfant ensemble, enfant célèbre puisqu'il s'agit de Roland de Roncevaux... ce qui explique que le dénommé Charlemagne pourtant très pieux, ne fut jamais canonisé par l'Église)''
** %%Blue(d'une certaine façon, c'était son neveu puisque le fils de sa sœur, mais il en était néanmoins le père puisqu'ils le firent ensemble... à noter que c'est la version retenue par le plupart des historiens modernes)%%
[http://www.bloglouco.com/wp-content/uploads/2008/06/bia-branca-feres-paparazzo.jpg]
* Les frères cyclistes : les frères __Garin__, Ambroise (2ème de Paris - Roubaix 1901), Maurice (vainqueur du tour de France 1903) et César (2ème de Paris -Roubaix 1904)
* George et Ira Gershwin, compositeur et parolier américain
* Les __Goldman__ : Jean-Jacques, chanteur à succès, Robert, compositeur, Evelyne, médecin, et leur demi-frère Pierre, militant gauchiste et [assassiné en 1978|ListedAssassinatsdAssassinesEtdAssassinsCelebres] par "Honneur de la Police", crime resté impuni
* Isis et son frère Osiris - par ailleurs son mari
**µµLeur histoire constitue l'une des souches du mythe jésusien: quatre frères sont aussi donnés au personnage de Jésus dans les évangiles synoptiques Mc et Mt (dans un passage copié de Mc avec une variante): Jacques, Simon, Judas et Joset (Mc) ou Joseph (Mt). Les narrations évangéliques sont situées durant une période d'incessantes luttes d'indépendance, précédant la destruction complète par l'armée romaine du temple de Jérusalem, en l'an 70: d'o๠la référence aux Maccabées, héros de la libération.µµ
**µµLe 4e évangile serait le plus ancien des évangiles canoniques, en tout cas certains éléments le constituant. C'est celui qui a le plus été réécrit, à l'évidence. La fin n'est sans doute pas d'origine (arrestation, jugement, martyre, mort et résurrection); celle-ci est commune à Mt, Mc, Lc, Jn et constitue toute seule l'évangile dit ''de Pierre'' (dans lequel on notera que le personnage supplicié n'est jamais appelé ''Jésus'', mais toujours ''le seigneur'')... Dans le 4e évangile: un personnage également appelé Lazare, qui est ''éveillé'', un autre personnage également surnommé le ''favori'' (en l'occurrence le narrateur, du moins celui d'une des strates de rédaction du texte); et il est hautement probable qu'au fil du temps, un seul Jean au départ (qui donne son nom à l'évangile) se soit dédoublé en Jean (le Baptiste) et Jésus (nom qui signifie simplement: Dieu sauveur/ Sauveur). La date de la purification du temple par Judas Maccabée, soit le 14 décembre ~164, est commémorée lors de la fête juive de la dédicace (Hanoucca), fête à laquelle il est fait allusion en Jn 10,22-42: l'histoire des Maccabées faisait partie de la culture populaire vivace à l'époque de rédaction(s) du 4e évangile, elle était un incontournable référent pour un mouvement ''messianiste'', ''chrétien'' ou plutà´t ''christien'', dans le sens primitif, étymologique, de ce terme, le seul qu'il pouvait revêtir en ces temps.µµ
* Les frères musiciens chtarbés : Ron et Russell __Mael__, fondateurs (dès 1968 !) du groupe Sparks
* Les sœurs __Mirabal__, Minerva, Patria et Maria-Teresa (["Las Mariposas"|http://www.27febrero.com/hermanasmirabal.htm]), héroà¯nes de la résistance dominicaine, à qui l'on doit la date de [la journée de la lutte contre les violences faites aux femmes|http://www.femmes-egalite.gouv.fr/grands_dossiers/dossiers/violences/pourquoi_25novembre.htm] - ah bon, mais si il y a juste par an une journée contre, ça en laisse 364 o๠l'on a le droit de taper sa femme tranquillement...
* Les frères du basket, Tony (Tipi) et Terence Jonathan (Tidji) __Parker__ aussi [fils de|ListeDeFilsEtDeFillesQuiFontLeMemeMetierQueLeurPereOuLeurMere] Tony Parker Sr
* Les frères __Schlumpf__ (et leur collec de Bugatti financée par la déroute de leur empire industriel)
* Les frères __Séchan__. Parmi six frères et sœurs sont connus : Renaud, chanteur renégat(mais pas David, son jumeau méconnu) et Thierry, écrivain teigneux
* ''Trois freres unys%%% trois licornes voguant de conserve %%%au soleil de midi parleront %%%Car c'est de la lumière que sortira la lumière%%% et resplendira la croix de l'Aigle'' µµdans Tintin et le secret de la Licorneµµ
* [Numb3rs|http://numb3rs.org/], série policière étatsunienne mettant en scène les frères Don et Charlie Eppes, l'un Flic et l'autre mathématicien. La série est produite par les frères Ridley et Tony Scott
* Les Parques et les Erinyes
* Marthe, Marie-Madeleine (dite Mary-Mad) & [Lazare|http://www.paris.org/Gares/Saint.Lazare/] sont cités comme sœurs et frère uniquement dans le 4e évangile - avec une mention-raccord de Marthe et de sa sœur Marie dans Lc. La résurrection de Lazare n'apparaà®t que dans le 4e évangile! (ce qui serait complètement inexplicable si ce récit, au demeurant d'une absurdité sidérante, avait correspondu à une quelconque réalité passée) ! dans Lc (qui semble constituer la compil la plus aboutie de ces patchworks ineptes), Lazare est seulement le nom d'un personnage d'un récit ''parabolique'' mis dans la bouche de Jésus.
**µµla plupart des noms cités dans le nouveau testament sont particulièrement désincarnés; ils ne sont la plupart du temps que... des mots, dont il est parfois difficile de saisir l'intérêt de l'apparition à tel ou tel endroit dans le texte.µµ
* Les __Funk Brothers__, groupe de musiciens studio de Detroit (Michigan) qui a participé à l'enregistrement de la plupart des albums du label Motown entre 1959 et 1972
* Les frères Ennemis µ(dont un a mystérieusement disparu)µ
%%Image(http://www.parkfunworld.be/dossier/parcs_div/walibi_belgium_2005/bob_bobette.jpg,178,300)%%
* Dupond & Dupont (par ordre alphabétique - ah bon, ils ne sont pas frères ?)
* Melchior, Gaspard & Salmanazar - µEuh, ça ne serait pas Balthazar ?µ--
* le frère de Proust, qui n'est JAMAIS évoqué, fà»t-ce par la moindre allusion, dans toute la ''Recherche du temps perdu'' - sa sœur non plus d'ailleurs (c'est qui celle-là ), ni même sa tante µµ-- Pourtant, Proust a écrit : "Longtemps, je me suis couché sur une bOOnne sœur" µµ
* Sœur Sourire (["Dominique nique nique..."|http://www.paroles.net/chansons/14044.htm])
Liste créée par kindofblue... "Longtemps, je me suis listé de bonne heure"
*µ Liste reclassÉe par JoZgurµ
ListeDeGadgetsEtPiegesaGogos
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* le cadran a 9 effets sonores (1 par touche) qu'on entend dans la plupart des chansons de l'album Clandestino de Manu Chao
* clic-clac (?) une demi-douzaine de carrés de bois reliés par des ficelles qui se replient en faisant clac clac quelqu'un s'en souvient ? Bien sûr... pis ça changeait de couleur....
* Une partie non négligeable des bricoles du [Catalogue de l'homme moderne|http://www.lhommemoderne.com/] %%Red(c'est vrai ! quels attrape-c... !!)%%
%%Blue(µ(offert gracieusement par le Ouaibmaistre pour deux listes achetéesµ)%%%µµ[bricole|http://www.lhommemoderne.com/produit.asp?reference=54803&TID=1&Monnaie=Euro] affectueusement offerte au Ouaibmestre pour son abnégation et sa bienveillance - merci (Echobot)µµ)%%
ListeDeJeMeSouviensDunTemps
* Je me souviens d'un temps où les champions s'appelaient Fausto Coppi (par exemple), et se chargeaient non à l'EPO mais à la grappa -- n'importe quoi ? essayez donc de monter un col après avoir bu de l'alcool !
** µSans oublier le dessineux et dramaturge argentin, Copi, qui, non content de ne pas faire de sport, ne suçait pas de la glace... (mis en scène par Alfredo Arias, notamment)µ
* Je me souviens d'un temps où je ne roulais pas en vélo parce qu'on n'avait jamais payé la taxe.
* Je me souviens d'un temps où Noelle Noblecourt avait été renvoyée de la télé parce qu'elle avait montré ses genoux (mais l'on sait aujourd'hui que ce n'était qu'un fallacieux prétexte, et qu'elle fut surtout virée pour avoir refusé les avances d'un ponte de l'ORTF...)
* Je me souviens d'un temps où la majorité de mes concitoyens savaient accordée le participe passé.
* Je me souviens d'un temps lointain où les gens qui n'écrivaient pas ne faisaient jamais de fautes de participes.
* Je me souviens d'un temps moins reculé où les gens avaient généralement entendu parler du participe passé. µµ(Ailleurs qu'à "Questions pour un couillon")µµ
* Je me souviens d'un temps où il y avait des cinémas spécialisés dans le porno, partout, et même Boulevard Saint-Michel
* Je me souviens d'un temps éloigné où on parvenait à s'envoyer des kils et des kils de Margnat-Village, et autres nectars, sans même avoir mal à la chetron le matin
* Je me souviens d'un temps où les individus branchés portaient des pattes d'eff - même que ça semblait impressionner les greluches du moment (par parenthèse, je préfère ne pas imaginer à quoi elles peuvent ressembler à présent)
**''Je ne crois pas que les ''putes'' puissent être comparé à se personnage. Pitié pour elles, elles soulagent l'humanité souffrante pour de vraie. (du moins celles qui ont de la conscience professionelle)''
* Je me souviens d'un temps où les boites à lettres servaient pour recevoir du courrier envoyé par des gens, au lieu de quadrichromies promotionnelles de merde, µµmais c'est mon côté vieux-con-réac- qui refuse d'admettre que tout évolueµµ
* Je me souviens d'un temps où les numéros de téléphone parisiens commençaient par trois lettres, µµtels ODEon, FLOrian, DALton ou JACuzzi...)µµ
* Je me souviens d'un temps ou les données à conserver étaient gravées au burin sur des livres en pierre (au mont Sinaï par exemple).
* Je me souviens d'un temps où [les flippers avaient des compteurs mécaniques et ça faisait « Tchac-ka-ta-ka-ta...ka...tcha-ka-ta-ka » quand ils se remettaient à zéro en début de partie.|http://www.youtube.com/watch?v=5OOUDiEv9yU]
* Je me souviens d'un temps où 'Paris-Hollywood' était le summum de la [perversion|http://perso.wanadoo.fr/j.hanart/janv_03/Ph_120/ronde.html]. µµ- A propos, vous les avez gardés ?µµ
** ''µ c'est toujours comme ça au Japon, par contre la scato est autorisée, faut pas chercher à comprendreµ''
* Je me souviens d'un temps où l'on pouvait éditer une liste sans être pollué par des chinchards, brougnard, birman, segolène (j'en oublie?).-- µµj'ignore si vous en oubliez mais par contre vous vous avez oublié de lacer vos chausssures !µµ ''µµNon non c'est fait exprès... par contre les 3 s?µµ''
Souvenue par Jeg.
ListeDeHeu
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* 'tain !, qu'est-ce que t'as encore bu pour te mettre dans un pareil état ?!
* Bon sang, comment t'as fait pour choper un truc pareil !!!?
** Heu... par goût du contact humain
**** Heu... j'ai du lire ça quelque part
** Heu.... je te parle
ListeDeServicesApresVente
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** On attend de 14 à 18 heures que M. Orange vienne changer l'appareil défectueux
** Elle s'excuse, le livreur est parait-il passé , mais le nom étant mal orthographié, il n'a pu que laisser un mot dans la boite à lettres
** Essayer, en désespoir de cause l'appareil défectueux
FrancoRusse
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Personnellement, je n'avais mis aucun lien nulle part ; pas plus sur ce "je me souviens de FrancoRusse" qu'ailleurs ! (? ?)
** Ca a au moins le mérite de m'avoir appris une ficelle utile pour mes débuts dans les Wikilistes. Usant de la similitude graphique entre le "S" et le "F", à l'époque, Rabelais avait coutume de dire "On s'instruit mieux par Fuite que par Suite". Ca se vérifie.
ListeDeBarbarismes
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
*Mot considéré comme incorrect par les puristes.
*Par un barbarisme de la basse latinité, on a dit essere au lieu de esse, pour se conformer à la terminaison ordinaire des infinitifs latins; essere ensuite a été contracté en ser; et le futur est composé de cet infinitif et du présent du verbe auxiliaire: ser-ai, ser-as, ser-a. (August Wilhelm von Schlegel, Essais littéraires et historiques, 1842)
__Par extension__
__Vocabulaire apparenté__
* Martellation (inventé par un de mes élèves de 2de 2)
** Si toutes les listes présentes sur ce site devaient être importantes et originales... Et puis, on ne sait jamais comment ça va évoluer, une liste. Cela dit, un nouveau mot commencent souvent par un barbarisme, qui rentre ensuite dans l'usage. Par exemple, "désescalade" (1916?) et "dysfonctionnement" '1960?), sont depuis peu au Robert.
ListeDeMotsRendusCelebresParLesMedias
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!!%%Center(Liste de mots rendus célèbres par les médias)%%
* Parachute doré
* Part'ciper (qui est en train de perdre le 1er i)
* Partir à la faute ''(se planter, quoi)''
* Ce n'est pas très cool de modifier une liste, puis pour empêcher de voir quelle est la modif, d'aller se reconnecter avec un autre IP et refaire par dessus une modif "vide"...
Liste composée par El Jj
ListedArgots
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** De façon plus vaste le loucherbem fait partie du Largonji, parlé dans les abattoirs
* Slang - argot anglais fondé sur des paronymes et des formules rimées µc'est le cockneyµ
** exemple 2: "my problems" pour "my wife", parce que "problems in life ? that's your wife"
* On peut combiner. Exemple "Balek, dikave ce pèlerin qui s'est fait serrer par les lardus/arquepinces !"
* %%Red(Réponse)%% : meuh non ! Je sais que l'arabe s'écrit (et se lit) à l'envers, mais vous faites fort... En verlan, les voyelles sont molles. Au reste, les exemples de keuf, reum, teub, etc. devraient vous éclairer. ''-pas si molles que ça, dans tous les exemples que vous citez c'est à chaque fois la fin du mot qui est élidée : flic ->keufli-> keuf, mère->reumè -> reum, etc. ça ne marche pas pour arabe/beur, il manque un a. De plus, "beur" avait à l'origine un sens plus strict que simplement "arabe", c'était précisément un jeune de la 2ème génération, impossible de dire par exemple "un vieux beur" %%Red(-- On peut quand même dire "un p'tit beurre" ? --)%%, ça n'a pas de sens. D'où l'hypothèse de "rueb", ça n'a rien d'exceptionnel qu'un mot venu de l'arabe passe dans le langage courant en français (cf toubib, bakchich, etc.)...''
"jo*belin" est identique à "jo*belin". "jo*belin" est donc apparenté à "jo*belin".
ListeDePastis
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Cristal Anis, créé en 1884 par Manuel Liminana, très apprécié en Algérie par les pieds-noirs.
*Pastis Lou Garagaï, distillé par Janot, au pied du Garlaban.
*Pastis Lou Féli 45, jadis distillé par Félix Pernod.
*Pastis Coudert, encore un disparu de nos comptoirs...
*Pastis "fait maison" par Joseph Frances, à Autignac, avec du véritable anéthol venu de Belgique (!) et de l'alcool distillé, le 3/6, et plus alcoolisé que celui vendu dans le commerce.(Fabrication familiale interdite mais largement répandue en Languedoc...)
* French Coffee (comme l'Irish Coffee, mais en remplaçant le whisky par du Pernod - beuark)
* Pastis + eau chaude (potion antigrippale pratiquée par le regretté Paul Ricard, mort presque nonagénaire...)
Par [Sergio|http://leserged.online.fr]
ListeDeBonbons
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
[http://blog.siteparc.fr/images/bonbon.gif]
µµListe offerte par JoZgurµµ
ListeDeBonnesRaisons
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* parce qu'on m'a rien demandé
* parce que tes parents/curés/officiers/élus savent ce qui est bon pour toi
* parce que (var c'est comme ça)
ListedImperatifsCategoriquesetleurRaison
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* "Ne pas parler de corde dans la maison d'un pendu" : Il s'agit simplement d'une image signifiant qu'il faut éviter dans une conversation les sujets qui fâchent.
* Il ne faut pas allumer 3 cigarettes avec la même allumette, non pas parce que ça fait plaisir à Dieu (resp. aux Dieux) - µµon m'avait expliqué qu'avec une allumette on pouvait allumer trois cierges et que placer la cigarette au même niveau que le cierge ne pouvait être qu’un blasphèmeµµ - mais parce que cela est une mesure de sécurité datant des guerres de tranchées. Première cigarette, l'ennemi vous repère, 2ème cigarette, il vise, 3ème cigarette, il tire et boum ! µµ(et celle là elle est authentique)µµ [http://www.rue89.com/sites/news/files/assets/image/2010/10/2010_Cigarette_inside.jpg]
* Il ne faut pas mettre tous ses œufs dans le même panier, non pas pour faire joli, mais parce que si une mémère avec un landau vous rentre dedans sur la place du marché en faisant tomber votre panier, il n'y en aura que la moitié de foutue
* Il ne faut pas ouvrir un parapluie à l'intérieur d'une maison, non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce que ça dégueulasse partout avec la flotte. Et en plus vous prenez le risque de casser un tas de trucs (bibelots, lustres...) [http://www.labelleecole.fr/blog/wp-content/uploads/2012/11/parapluie-superstition1.jpg]
* Il ne faut pas taper sur les gens à lunettes, non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce qu'on peut se couper avec les verres cassés.[http://www.warm-upf1.com/catalog/images/Lunettes.jpg]
* Il ne faut pas passer sous une [échelle|ListedEchelles], non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce qu'on risque de se la manger sur la tronche.
**µce qui n'empêche pas les charlatans de déclarer le plus sérieusement du monde : "''La 1ère origine vient du triangle que l'échelle forme avec le mur. Entrer dans ce triangle magique signifie le profaner. D'autre part, plus "scientifiquement", un angle droit émet un champ de vibrations négatives dans l'axe de sa bissectrice, ce qui affecterait le psychisme''"µ[http://img.over-blog.com/300x335/2/27/28/17/PHOTOS/echelle.jpg]
* Il faut faire gaffe aux [chats|ListePourFaireDuChat] [noirs|ListeNoire], non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce qu'ils pourraient vous griffer, ou encore vous flanquer le [typhus|http://rat.eliminator.free.fr/Typhus.htm] (d'ailleurs les [chats|ListedElephants] [blancs|ListeBlanche] aussi, mais Dieu (resp. les Dieux) ne saurait songer à tout).[http://www.rosen-wakeford.com/images/chatlogo2.gif]
* Il ne faut pas manger le [cochon|ListeDeCochons], non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce que c'était risqué tant qu'on n'avait pas inventé le frigo.µµLa version du Coran "après frigidaire" est malheureusement introuvable !µµ
* Il ne faut pas sucer son pouce, non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce que ça coûte la peau du dos de se faire ensuite redresser les dents.[http://www.petitweb.lu/erny/probl/pouceconseils.jpg]
* Il ne faut jamais embarquer de lapins vivants à bord d'un bateau à voile non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce que [les lapins|ListedeLapins] grignotent n'importe quoi, et notamment les cordages !
* Il ne faut pas %%Queryword(TRANS+INF,*)%% les %%Queryword(NOM+PL+FEM,*)%% %%Queryword(ADJ+PL+FEM,*)%%, non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais pour ne pas %%Queryword(TRANS+INF)%% les %%Queryword(NOM+PL)%% trop %%Queryword(ADV,*ent)%%.
* Il ne faut pas laisser les petits garçons jouer à la poupée, non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce que les Barbie(tm) ça coûte la peau des fesses et parce que ça développe des tendances homos. -Devenue caduque avec la théorie du genre (ou du gender) [http://serge.glorian.free.fr/internet/BARBIE~1.JPG]
* Il faut se foutre un foulard sur la tronche pour aller communier si on est une dame, non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce qu'elles ont généralement les douilles un peu cradingues. µ%%Red(- Heu, t'es bien sûr, là ?)%% %%Blue(- Tiens heu... c'est pas une contrepèterie ? ah ben non... - Dommage !)%%µ
* Il faut assassiner Salman Rushddie, non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce qu'il est vilain.
* Il ne faut pas se toucher le zizi (resp. la foufoune), non parce que ça fait pleurer le petit Jésus (resp. au petit Bouddha), mais parce que ça rend sourd. -__ KOMMENT ?!__
* Il ne faut pas épouser maman (resp. papa), non parce que ça fait plaisir à Dieu (resp. aux Dieux), mais parce que ça pourrait énerver papa (resp. maman).
* Il ne faut pas tuer son prochain, non parce que ça fait plaisir au Bon Dieu (resp. aux Maîtres), mais parce que ça ne fait plus rigoler grand monde µ- ça dépend, par exemple si le prochain est un appétissant porcelet nommé Régis - ou un chinchard prénommé Albert ?µ
*%%Red(Qu'on nous explique en quoi le fait de transformer le mot respect par son abréviation serait un enrichissement de cette liste ?)%%
**µParce que ''resp.'' est l'abréviation de ''respectivement'' (qui signifie ''mutatis mutandis'' - askuzé-moi pour la cuistrerie) et non de ''respect''.µ
Liste démarrée par S.
ListedEthylophilesCelebresetDisparus
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Big(%%Center(__Liste d'éthylophiles célèbres et disparus__)%%)%%
%%Center((''disparus'' pour éviter les procès))%%
* Blondin Antoine, parti du carrefour de l'Odéon, n'a jamais pu rejoindre le quai Conti : trop de haltes sur le chemin (à ses dires).
* Brassens, Georges %%Red(__faux__)%%("Hélas, il ne pleut/Jamais du gros bleu/Qui ta-ache/Qu'elles donnent du [vin|http://www.paroles.net/chansons/23810.htm]/J'irai traire enfin/les va-aches...")
* Brel Jacques %%Red(__faux__)%% ("Parfaitement à jeun/ Vous me voyez surpris / F'plus retrouver mon lit...)
* Cassavetes John (tous les personnages de ses films picolent, et par moment même la caméra semble tituber)
* Collègue d'en face, Mon ''µ(et en plus , il parle tout seul)µ'' . Ne pas confondre avec le Collège de France.
* Et aussi quelques [chanteurs|ListedesChanteursquiontunegrossevoixquisentleWiskey] qui ne sont pas trop disparus encore, mais qui finiront bien par trouver une concession dans cette liste... µµ%%Green( - A propos, ne pas confondre les "petits Chanteurs à la croix de bois" et les vieux chanteurs à la gueule de bois. Sans causer de ceux qui déménagent furtivement à la cloche de bois...)%%µµ
*** ''encore des ragots ! bientôt Echolaliste va finir par ressembler à Gala''
* Kémal Mustapha (deux kils de raki par jour - enfin, à la fin)
* Le Général (où est-il, à propos ?) µµ[Il est à vendre !|http://www.paroles.net/texte/15355]µµ
** µUn pote, pourtant un pro de chez pro, s'est fait étendre, __solidement__ un jour au whisky par le toulousainµ
%%Center(µPortrait d'Utrillo par Picasso.µ)%%
* Il y a un truc encore bien pire, c'est ce genre de méthode de dénonciation avec intimidation ("j'ai ton numéro, tu es repéré, cache-toi "), dont l'auteur est évidemment un être parfait qui n'a jamais fait une coquille ni écrit une bêtise de sa vie ! Engage-toi plutôt dans un groupuscule de skins, pauvre petit flic de la pensée !
* Depardieu Gérard
** Il faudrait pour être juste ajouter ceux dont l'éthylisme fut partie intégrante de leur personnalité : que seraient "Au-dessous du volcan" sans le mezcal, "Gargantua" sans le vin de Chinon, et la voix de tous ces grands bluesemen sublimes sans le whisky, je vous le demande ?
***%%Blue(__*__ :µ"homme aimable")%% : résistance dans la section juive de la MOI (Main-d'ouvre immigrée)..., déportation au camp de Jawischowitz, une annexe d'Auschwitz, où, avec Samuel Radzinski - "Sam", là lui aussi, très éprouvé -, ils s'épuisaient, esclaves des nazis, au fond de la mine, seize heures par jour, à dix-huit, dix-neuf ans... Battu, torturé, éprouvé par l'assassinat des siens - Isaac, le père d'Henri, avait été gazé à Auschwitz même, quelques semaines avant la déportation de son fils, Léa, sa mère, avaient été contrainte d'assister à "l'interrogatoire" de son fils par leurs communs bourreaux - rendus à l'état d'esclave affamés, ces jeunes gens ne renonçaient pas. "Étrangers et nos frères pourtant", ils avaient entonné la Marseillaise à leur départ de Drancy, et là, au bagne de Jawischowitz, ils la murmuraient, un soir de Noël 1943, après que Roger Trugnan eût fait un exposé sur Molière et qu'Henri Krasucki eût sifflé l'intégrale de l'allegretto de la 7e Symphonie de Beethoven.µ
***µµLà, vous parlez à nouveau de Jojo, je suppose, car pour Krasu, je ne vois pas trop ce que vous voulez dire.µ
** Célébrités qui font des choses interdites (quoi donc, par exemple ?)
** Par contre Pascal et Saint-Yorre démontrent que l'on peut être abstinent et génial.
Liste lancée par erreur un soir de grand vent et par Foo-Fouhn (sur zone)
ListedeProjetsdeListes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [Liste d'acronymes historiques|ListedAcronymesHistoriques] (exemple : l'IPACTE et l'IGRANTE ont été remplacés par l'IRCANTEC )
** et derecho %%Red(µµtiens ! c'est marrant que celle-ci soit masculine par rapport à l'autre + hautµµ)%%
**µOn __transferera__ dans cette liste les remarques du style ''encore une liste inutile'' dont de valeureux anonymes parsèment les listes créées par les participants de ce wiki. Je ne pense pas que cette liste fasse double emploi avec la "Liste de gentillesses....". Cette liste sera nettoyées de temps en temps.µ
**µOn y __ajoutera__ avec bénéfice tous les "c'est votre avis" et "vous trouvez ça drôle" que certain(s) godulereau(x) semble(nt) particulièrement apprécier de lâcher ça et là à loisir dans les listes.µ
**µÇa nous éclairerait peut être sur la fréquentation très élevée de certaines liste (je trouve très bizarre, par exemple, qu'on s'intéresse 6 fois plus aux éléphants qu'aux singes)µ
* Liste de mes kouyes (liste binaire)µ(vous voulez parler d'une liste de bits ?)µ
* [Liste de nichons|ListeDeMamelles] (sava généralement par paire)
ListedeDebats
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Mais non puisqu'on en connaît au moins 2 occurrences : Arthur Rimbaud ("ô flots abracadabrantesques...") et Jacques Chirac (au sujet de quoi déjà ? il a réussi à nous faire oublier l'accusation de départ, le *£$¤§!!!)
* Compléter les listes par le haut ou par le bas ?
* De quoi sont les pieds ? (Rep les pieds sont l'objet de soins attentifs de la part du fantassin)
* Est-ce que le ouaibmaistre se moque de nous ? µ(Le Ouebmestre est tout-puissant, infini et éternel. Le Ouaibmestre est infiniment juste, parfait, sage, saint et bon, omnipotent, omniscient, et omniprésent, c'est-à-dire présent partout et n'importe où et dans tous les temps en même temps. La perfection du Ouaibmestre excède infiniment plus ce que tout listeur peut imaginer ou démontrer. Le Ouaibmestre n'est pas un être parmi tant d'autres mais l'Être absolu et illimité) -- tout à fait d'accord. Comme [quoi|http://www.echolalie.com/l1175.htm]. (LW) µ
** µPas de lézard; quant à moi, j'ai également coutume de me faire cirer les pompes, ce qui me permet de participer à l'économie du pays et par ailleurs de nourrir le cuir de mes godasses.µ
** µµParlant de matrice, "Coïto ergo sum" serait plus indiqué. Mais, c'que j'en dis, n'est-ce pas...µµ
* Georges Brougnard a-t-il été [enlevé|http://rr0.free.fr/1961_Hill.html] par des extra-terrestres lors de son excursion à Madagascar en 1972 (en 4x4) ?
** µSur ce Wiki et par faveur exceptionnelle les taureaux pourront s'exprimer, et tiens, pendant qu'on y est les toréros itouµ
** µJeune c..., saoul de pastis, de paroles et de musique j'ai adoré ce spectacle ; vieux c... je réprouve sa barbarie ; "il n'a rien compris" diront les aficionados.µ
* La première langue indo-européenne se parlait :
** µEt par suite, est-il loisible de venir à l'école en soutane léopard ?µ
*** Par contre ils nagent très bien
* Les Anasazis ont disparu brusquement à la fin du XIIème siècle :
** parce qu'ils en avaient envie et puis c'est tout !
* Les terribles %%Queryword(FEM+PL)%% %%Queryword(ADJ+FEM+PL)%% %%Queryword(VER,*raient)%%-elles avant de partir %%Queryword(ADV)%% à l'école ?
* Pourquoi la plupart des restaurants s'autorisent-ils à servir d'abominables piquettes qu'on n'oserait même pas faire boire à nos ennemis ?
** Faux : la 204, à cause de son moteur transversal, avait le trou de manivelle accessible par le côté, après démontage de la roue avant gauche. (Vrai)
* Un record battu par un champion dopé est-il valable ?
* Une encyclique publiée par un pape drogué est-elle valable (ie validée par Dieu (resp les Dieux)) ?
* Une variété de dimension 3 simplement connexe bornée et sans bord est-elle homéomorphe à la sphère de R4 ? ([conjecture|http://www.claymath.org/Millennium_Prize_Problems/Poincare_Conjecture/] de Poincaré et l'un des sept "Millennium prize problems" proposés par la fondation Clay. Résolue semble-t-il par le mathématicien russe G.Perelman, ce qui lui vaudrait un million de dollars de récompense... - J'allais oublier : la réponse est oui !)
* Y a-t-il des nombres parfaits impairs ?
* Y a-t-il des profs parfaits ?
ListedOrdreDuJourDeux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
µ- Alors, Mamie, où en sommes-nous de ces préparatifs? Notre invité arrive donc à sept heures et demi. J'aurai%%Red((s))%% d'ailleurs dû lui dire huit heures.%%%- Pourquoi?%%%- ça fait plus chic. Chez les Kanakis, les dîners sont toujours à huit heures, chez les Rasset et les Johnson aussi.%%%[[...]%%%- La règle est de venir avec un peu de retard, dit Mme Deume. Quelle heure est-il?%%%- Quarante-neuf répondit [http://www.poker-rooms-review.org ideal poker] Adrien.%%%- Oui, poursuivit-elle, les gens bien élevés viennent toujours avec un peu de retard, au cas que l'hôte ne serait pas tout à fait prêt, c'est une attention, une délicatesse.%%% Egaré, M.Deume répéta intérieurement "au cas que l'hôte" qui devient bientôt ocaclotte, ocaclotte. Les trois restaient debout et attendaient, figés dans la distinction souriante et malheureuse.µ
*** µµ%%Green(--(pardon pour la question de)%% #####bleu##### %%Green(: y a-t-il un forum, si oui comment s'y rend-t-on, et est-ce ouvert après minuit ?)-)%%-µµ
** [Transcendance|ListeDeNombresTranscendants] de la fonction ζ(3) -- un scoop du Secrétariat, commenté par le Président
** communication sur la disparition de la liste rose
* proposer la création du prix "Georges Brougnard". Ce prix récompense la liste la plus appréciée par les membres d'Echolalie. Son attribution est déterminée par un vote (le président a 2 voix, et 2 grands boeufs dans son étable) des membres présents à l'assemblée générale (de mes deux). La liste reçoit symboliquement le chinchard d'or, avec mention expresse à la préfecture (des Deux-Sèvres).
** OUI! ça va concurrencer le Renaudot et tout ça. On en parlera dans Libé et Télérama
** - Patricia, mon petit, je ne voudrais pas te paraître vieux jeu et encore moins grossier... L'homme de la pampa parfois rude, reste toujours courtois... Mais la vérité m'oblige à te le dire: la systématisation des "notes & commentaires" commence à me les briser menu!
***** %%Green(µJ'ai la solution : ''ne lisez pas les parties que vous ne voulez pas lire'' (non, non, ne me remerciez pas; c'est toujours un plaisir pour moi d'aider mes semblables).µ)%%
** Possibilité de distinguer le bleu des liens du bleu commandé par $$Blue(...
**** µµ%%Green(- Bon sang, vous avez raison, mon bouzin était paramétré avec les pieds !)%%µµ
ListeDeYaourts
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* YAOURT, YOGOURT ou YOGHOURT. Lait fermenté préparé à l'aide de ferments
lactiques acidifiants; pot de cette préparation.
* Chanter en yaourt (c'est-à-dire dans un pseudo-anglais, sans réelles paroles)
__Apparitions du yaourt ici ou là__
* Des mélanges de parfums de yaourt
* En enduire le corps de sa (de son) partenaire et lécher tout ça... -- ça ne vaut pas le nutella, mais bon...
ListeDeJuillet
/* par PITIE ne mettez pas de liens vers de GROSSES images, sinon on supprime les vacances. merci
** En juillet, visitez le Paraguay
** 14 juillet chanté par Brassens ("Le jour du 14 juillet, je reste dans mon lit douillet : la musique qui marche au pas, cela ne me regarde pas.") ([La mauvaise réputation|http://www.comnet.ca/~rg/ch_b015.htm])
** 14 juillet chanté par Piaf ("Si tu ne reviens jamais, il n'y aura plus de 14 juillet...")
** 14 juillet chanté par Ferrat ("Quatorze, c'est fou ce que t'es triste quand sur un édifice t'es suivi de dix-huit, Quatorze, c'est fou ce que t'es gai quand au calendrier t'es suivi de __Juillet__ ) qui ce jour là avait du fumer la moquette - ''la fête aux copains''
* 28 juillet 1909 : Première traversée de la Manche en avion par le français Louis Blériot
* Colonne (de) %%Image(http://www.hberlioz.com/Paris/BastilleB.jpg,300,208)%%
*__nid__ : Les oiseaux non-nicheurs qui découvrent les nichoirs trop tard, par exemple mi-juillet, ne nichent plus cette année, mais remarquent la place pour l'année suivante! - µrappelons à ce propos que lapinicho et que l'wanichba (la pie niche haut et que l'oie niche bas...
* Sécheresse (parfois)
* Pierre Juillet, éminence grise du président Pompidou, homme de l'ombre, sa photo n'est indexée nulle part par Google Image !
ListedePianistesClassiquesaprioriBienConsideres
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Liste peut-être pas exhaustive, mais néanmoins assez fournie. On notera en particulier la variété des écoles représentées.
Liste proposée par Roger (Rabbit ?) -- µµNon, par S.µµ
ListedeRecommandations
/* par PITIE ne mettez pas de liens vers de GROSSES recommandations. merci
**...et faire en sorte de se souvenir du code µµ(faite facile, ajoutez 4 par exemple)µµ
* Commencer par les fromages les moins relevés et ainsi de suite %%Smiley(smfaim)%%
* Ne jamais accepter des bombons offerts par un inconnu dans la rue
* Ne pas oublier son parapluie dans le métro
* Ne pas se laisser anesthésier par de vains scrupules
* Ne pas se tromper de paire de godasses (resp de slip) en repartant
* Nous expliquer ce que signifie ces __resp entre parenthèses__ qu'un plus malin que les autres a collé partout
* Pas plus de deux cuites par jour
* Préparez l'appoint
* Prière d'entamer la baguette de pain par le bon bout.
* Se parfumer mais sans exagération
* Se souvenir que personne n'est parfait, y compris vous et que néanmoins certaines personnes font ce qu'ils peuvent.
* Si vous ne voulez pas qu'on vous regarde par le trou de la serrure quand vous êtes aux toilettes, laissez la porte ouverte.
µµListe proposée par Léon (d'Ixelles) sur une idée de liste apparue peu de temps auparavant.µµ
ListeMinimaleMaisCependantExhaustive
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* %%Green(Avez-vous entendu parler de William Shakespeare ou d'Oscar Wilde ?)%% -- oui
* %%Green(Difficile en effet de faire plus dépouillé - si ce n'est avec la liste contenant simplement l'ensemble vide, voire la ListeVide elle-même (mais est-elle autorisée par les statuts ?) -, et cette liste marmoréenne mérite un prix de beauté. J'espère par ailleurs que George Boole ni Charles Babbage ne vont en concevoir de dépit.)%%
* Exégèse : La liste vide, ne contenant pas plus de 666 éléments, est évidemment autorisée par les statuts. Qui osera ? %%Red(- Devinez.)%% %%Blue(- Raté, elle existe déjà...)%%
ListeDeLmmce
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Ca marche/ça marche pas µ(le wiki, par exemple...)µ
**Château-Haut-Brion (par dérogation, c'est un Graves - Pessac)
**Château-Mouton-Rothschild (depuis 1973, c'est un parvenu - Pauillac)
* µC'est une impression ou les listes deviennent de plus en plus ésotériques ??... %%Green(- serait-ce parce que le niveau s'élève ?)%% Pffff ! -- Osons ésotériser, les wikistes !! On n'est pas des billes. (LW)µ
ListeAbregeeetPortativedeSynonymespourDesignerleMinoudesDames
/*par PITIE ne mettez pas de liens vers de GROS minous. merci
%%Center(µOh le joli minou que voilà ! : ''L'Origine du monde'', peint par Gustave Courbet et visible au musée d'Orsay à Parisµ)%%
**Abricot de la jardinière -- µ%%Red(Meuh non...C'est "de la cantinière" !)%% -- les deux sont possibles, non ? -- Sans aucun doute ! Mais je me référais aux classiques : [ici|http://www.remede.org/spip/article646.html] (cinquième paragraphe)µ
*Aramis (''µAthos et Porthos étant les [seins|ListeDeMamelles] et d'Artagnan le [cul|ListeDeMotsRelatifsAlaPartiePosterieuredesHumains] !µ'')
*Barbadjouj µ(occitan certainement, par analogie de forme avec une plante grasse résistante)µ
*Beaver : Mot anglais pour désigner le castor (dérivé du vieux français bièvre) mais qui sert aussi à désigner le minou de la femme. Le sachant on comprend mieux le jeu de mot "Save a tree, eat a beaver " qui traduit en français par Sauvez un arbre, manger un castor perd tout son sens grivois !
*[Berlingue|http://jpgallou.free.fr/dames.html] µ(la partie pour le tout - %%Blue(''"Défoncez-moi encore le berlingue, Charles-Hubert"'')%%)µ
*Chapelle µ(pas la Sainte !!! -- si parfois...)µ
*Chouchoute ''µ(employé en Nouvelle-Calédonie par les "Blancs", les mélanésiens préférant le terme de "Yossi")µ'' -- ''µCurieuse parenté, quasi homophonique, avec le "Yoni" oriental... Si on se faisait une petite thèse ?'' (utilisé à l'île de la Réunion)µ
*Choune, chounette : Le sexe de la femme (définition réapparue vers l'an 2000 ! Désignait jadis une jeune fille aimable, souriante, gracieuse, coquine, malicieuse... il y avait dans les villages de la France profonde des concours de chounes (on dirait aujourd'hui concours de miss). Dans certaines régions la choune c'est "la chance".
*Cigale µ(parler méridional)µ
*Conin (ou connin, connil, cunin) (µce mot à longtemps désigné à la fois le sexe de la femme et ... le lapin, ce sont les premiers « restaurateurs » qui changèrent le nom au 18e siècle, le conin aux grandes oreilles devint le lapin et le sexe de madame finit par trouver un autre totem animalier... le minou justementµ)
*Craquouse : sexe féminin (''Sa craquouse ne chomait pas lorsqu'elle était en partouze'')
*Escalopes (par [métonymie ?|http://www.ucalgary.ca/~dmaher/figures.htm] - µ%%Blue(Bof, tant qu'elles ne battent pas les chevilles)%%µ)
*Fente (''µLe paradis ne serait-il qu'une fente ?µ'' - µµAnne Archetµµ)
*Feuilleté (µ%%Blue("''Trente sacs dans le feuilleté, cinquante dans le joufflu''")%% - tarifs aimablement communiqués par la Chambre de Commerce de Pantaléon-sur-Artubieµ)
*Fleur (comment sa fait-il que ce terme soit absent de la liste, ça me semble être le plus courant ?! Celui qu'utilise toutes les mamans pour parler du sexe de leur petite fille ? non ?)
%%Center(µµL'origine du monde vue par [Facebook|ListeDeCensures]µµ)%%
*Garage à bites (µ''assez peu poétique, il faut bien l'avouer''µ) Y avait aussi grange à bite, donc par extension: pour les anciens, Valérie Lagrange (à bites). Oh j'ai honte, tout compte fait pas tant que ça.
*Hérisson ''(employé par les chroniqueurs des frasques de la reine [Margot|http://lassilia.voila.net/Margot.htm])''
*Maljoint : ''(Nouveau lexique érotique, illustré par Otusé, édition "L'Archange Minotaure")''.
*Marmotte : sexe d'une prostituée. (Source : Le parler des métiers, Pierre Perret) ''"Tu te rends compte, il m'a versé des arrhes pour que je laisse repousser les poils de la marmotte !" ''
*Maryland : la foufoune, ou plutôt, par analogie au tabac, ses poils.
*Paraguay ''(µMonique m'avait exhibé son Paraguay...µ)''
%%Image(http://marjorie-art.voila.net/Voyage/Paraguay004.jpg,175,250)%%
%%Center(µµoui, mais là justement, on ne le voit pas bien, son Paraguay !µµ)%%
*Parenthèse
*Petit intérieur (''µLa Julie, ma belle copine qui bosse à l'extérieur me suggère de m'occuper de son p'tit intérieur'' - Boris Vian, repris par Henri Salvador (Je ne peux pas travailler.µ)
*Pussy parce que Pussy-cat
*Tarte aux poils µ(''cela désigne plus particulièrement le cunnilingus'' %%Blue((ou "minette") - cela n'est point contestable, mais la métonymie n'est pas proscrite...)%%)µ
*Taupinière ''Ginette, assise sur ses genoux, sentait la grosse limace frapper à la porte de la taupinière'' -µµpar ailleurs, excellente spécialité fromagère des Charentes (chèvre)µµ
**Triangle du Bermuda (par similitude avec le précédent)
* [Vagin|http://mapage.noos.fr/echolalie/x32.htm] µ''(le vagin n'est que la partie interne du sujet de cette liste -- C'est grave Docteur ? -- Et la métonymie, c'est pour les sourds ? -- Waooo... le dialogue de... sourds ? Rien de mieux qu'un monologue)''µ
* Vulve µ''(la vulve n'est que la partie extérieure du sujet de cette liste -- voir plus haut)''µ
* Watchi, ou watchibole (''µIl me caressa la watchibole et le bobomalibole -- Point sot, et quel effet en retira-t-il (je ne parle point de vous) ?µ'')
* Yossi µ(''employé en Nouvelle Calédonie par les Mélanésiens, les "Blancs" utilisant plutôt le terme de "Chouchoute"'')µ
*Zigounette : employé parfois pour désigner le sexe féminin, zigounette est néanmoins principalement employé pour désigner le sexe masculin
*Zizoune ''Penaude, la soubrette finit par avouer que le jardinier avait mis sa grosse carotte dans sa zizoune...''
* La sportivité interdit (bien) évidemment de procéder à un ''copier/coller'' depuis l'un des nombreux dictionnaires d'argot présents sur le marché... - il faut pourtant bien qu'on aille chercher tout cela quelque part, non ?
* Ni la faucheuse (la mort), etc. µµcertains ne peuvent pas s'empêcher de ne pas parler comme tout le monde...µµ
*De conin, qui signifiait lapin en vieux français mais désignait également le sexe féminin, ne demeure que le con. On a remplacé lapin par chatte. Le sexe est devenu carnivore. ''Roland Topor''
* La nuit tous les chats sont gris, mais les chattes, il n'y en a aucune de pareille. ''Pierre Perret''
**''Ceux qui professent ces beauf réflexions (les 2 dernières) devraient savoir que ce pot d'échappement est souvent bien agréable à butiner, cette spécialité se nomme d'ailleurs ''feuille de rose'' (cf plus haut) et est très prisée des spécialistes - voire des simples amateurs. Quant aux décharges, elles réservent parfois de douces surprises. Décoincez-vous que diable !'' µµDe toute façon, quand la grand'route est inondée, on passe par les petits chemins boueuxµµ
* Sainte Marie mère de Jésus, vous qui avez conçu sans pécher, permettez-moi de pécher sans concevoir. ''Citation parfois attribuée à Colette, mais son auteur est Anatole France.'' /* - Pêchaient-elles le loup ? -- dans ces cas là, on corrige calmement au lieu de ramener sa suffisance.
*Biniou (µ%%Blue(là, c'est en haut! - voir la [partie espagnole|ListedEchecs])%%µ)
*Pastille de menthe ''(Il ne faut pas confondre trou du cul et pastille de menthe, ça se suce tous les deux mais ça n'a pas le même goût.) - Le minou n'est pas concerné par cette comparaison :-)''
*Ticket de métro ''(je lui aurais volontiers poinçonné son ticket de métro...)'' - Le ticket de métro désigne une forme de rasage partiel de la toison pubienne ressemblant à... un ticket de métro.
** Non, désolé, cher ami, cette expression est bien antérieure à la mode des "strings" et des rasages ad hoc. Elle date de l'époque où les tickets de métro étaient poinçonnés - manuellement - par le préposé de la RATP de service...''(Le poinçonneur des Lilas: "Des trous, des p'tits trous encore des p'tits trous....")''
*Tuile ''(Le sexe des femmes, il est certain qu'on l'a déjà comparé à tout, mais peut-être pas, ou pas assez, à une tuile. - Maurice Chapelan)''
%%Center(µ"Angélo" par Roland TOPORµ)%%
µµListe déposée et initialisée par S. le 16 juillet 2003, pour l'édification de ses contemporains - et plus ou moins harmonieusement enrichie par divers contributeurs aussi talentueux qu'anonymes...-- Bon, on trouve ça partout -- même pas vrai ! -- sur le Net, même dans Echolalie :-( -- On a aussi la ListeDeBite - C'est fini, espérons. - Rappelons qu'à quelques rares exceptions près, une liste n'est ''jamais'' finie, sapristi ! et qu'en ce qui concerne le nombre de listes, le nombre s'approche sans doute de l'infini...µµ
ListeDeResumesDeFilmsaVoirAbsolument
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
Doublon ----> transférée partiellement ici : ListeDeGrandsRecitsResumesEnUnePhrase
* Un boxeur tue son adversaire alors qu'il devait se coucher dans une manche pour gagner de l'argent. Les méchants veulent sa peau mais il gagne et part avec sa fiancée.
ListeDeKingGeorges
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListeDeParonomases
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(%%Blue(''je l'ai trouvé [ici|http://mapage.noos.fr/echolalie/l14.htm] !!!'' __Paronomase__)%%)%%
%%Center(%%Blue(µMouais, c'est pas tout à fait ça , une paranomase, mais on va faire comme si...µ)%%)%%
Mais non ! la paronomase, c'est l'utilisation dans un énoncé de paronymes, autrement dit de deux mots qui se ressemblent sur le plan de la forme(ce sont presque des homonymes) mais qui diffèrent sur le plan du sens. Ex: illusion et allusion sont des paronymes. Les utiliser tous les deux dans un énoncé (ex : les allusions de nos illusions) c'est faire une paranomase.
! Liste de Paranomases qui, en fait, sont des Antanaclases ! ça a de la gueule !
* Les paronomases ne sont pas des paranomases
* Les murs murant Paris rendent Paris murmurant (hommage à C.N. Ledoux)
* La part part
On ahana : « Si elle apparaissait plus tôt ? » %%%
On a Anna, ciel ! À part : « Essaie plutôt %%%
* c'est ici que les romains ramèrent / que les athéniens s'atteignirent/que les perses percèrent/ que les spartes partirent/que les tanks...etc.
ListeDeLots
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Radler (lot offert par Le Seuil)
ListeDeViensChezMoi
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeMajorsLitteraires
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* __Le Major__, personnage excentrique récurrent de Boris Vian (inspiré par Jacques Loustalot, mort le sept janvier 1948 en s'échappant d'une party par la fenêtre comme d'habitude).
** Apparaît dans ''Trouble dans les Andins'' (1942-1943, édité en 1966)
** Le Major se bagarre dans ''Surprise partie chez Léobille'' in ''Le-loup garou''
** a la gorge tranchée dans ''Miss Marple: Le major parlait trop'' (1964)
** remplacé par Mr Q pour cause de changement d'acteur
*** apparaît dans l'histoire ''The Long Tomorrow'' (15p, scénario de Dan O'Bannon), réédité dans ''L'Homme est-il bon?'' ([première planche)|http://www.bulledair.com/index.php?rubrique=planche&album=long_tomorrow]
** Apparaît dans ''Space Oddity'' (1969) de David Bowie, réapparaît dans ''Ashes to Ashes'' (1980), ''Hallo Spaceboy'' (1995)... mais pas sur ''Life on Mars?'' (1971) qui parle d'incommunicabilité.
** Personnage repris par Peter Schilling dans ''Major Tom (Coming Home)'' (1983) chanson merveilleusement massacrée en français par [Mastic Ferblanc|http://www.youtube.com/watch?v=hjuwLZbLP0M]
** ''Rocket Man'' (1972) d'Elton John serait une allusion au Major Tom: la chanson parle d'un travailleur de l'espace. À ce compte-là, il faudrait verser des droits à David Jones chaque fois que l'on parle d'un astronaute, sauf ''Colargol sur la lune'' (Victor Villien et Mireille) qui date de 1963.
ListeDesListesImpulseesParJchrbe
ListeDeCeQueJauraisPuSi
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* J'aurais pu mettre Paris en bouteilles si j'avais eu des si
* J'aurais pu lui parler si j'avais su comment µ''(j'aurais su lui répondre s'il avait pu me parler)''µ
LiSteDeTrIbUlaTiOnsDeNoTrePrEsiDentAvIe
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* C'est par un petit matin de printemps, comme il reposait au pied d'une montagne, qu'il reçut des mains de Jupiter en personne, le frétillant chinchard sacré, symbole de la mission fondatrice qui allait donner tout son sens à sa vie
%%Center(µµ__Dans le rôle de Méphisto, opéra de Paris, 1954__µµ)%%
** Des films torrides, partenaire préféré de Paris Hilton
%%Image(http://palladio.free.fr/gaspard.jpg,127,169)%%
%%Center(µµ__Gaspard Tramu, ingénieur du Roy, en extase devant sa première liste__µµ)%%
ListePourSeProtegerDuFroid
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* M. mettait un journal à l'intérieur de sa parka quand il faisait du vélo quand il était petit pour couper le vent glacé
bavardage un samedi matin par -6° à Vesoul [http://images4.hiboox.com/images/0709/a11b5fa3841efb180eaf9fa52fb8b4d7.jpg]
ListeDeTitresDansLeJournal
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Clinton et Elstsine : ils ont parlé de roubles ignobles (Le Canard Enchaîné)
*Mouais... il suffit pour ça de s'abonner à Libé et au Canard, non ? µoui, et à Hara-Kiri. (Mensuel ? Non ! Hebdo -difficile...__Charlie__ Hebdo... Et si vous ne voulez pas l'acheter, volez-le !), et aussi au Progrès de Cornouaille, apparemment...
ListeDeFilmsInspiresDunePieceDeTheatre
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Le crime était presque parfait (Alfred Hitchock, 1954)
ListeDeMotsenLoguesdesProfessionsouPas
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListedInterdits
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**De __cracher__ par terre
* Il est interdit de laisser son __attaché case__ sur le sol, (parce que ça risque de faire culbuter la petite serveuse). [http://www.prevention.ch/ima6208.gif]
* Il est interdit de se __baigner__ par temps d’orage dans les eaux de Soustons (Landes).
* Il est interdit de faire du __bruit__ dans le Parc National des Pyrénées.
*Dans les allées du parc de Chantilly dans les années 60, il est interdit de __courir dans les allées__.
*Dans une église parisienne ("une église qui se visite" comme dirait Antoinette) je ne me souviens malheureusement plus laquelle, et au dessus d'un magnifique et authentique bénitier (c'est à dire en coquillage) : L'usage de l'__eau bénite__ est réservé aux fidèles.
* Interdit par la __justice__ (à la botte de la calotte). [http://vassilia.net/vassilia/gazette/imagesnews/cenecensure.jpg]
* l'Envoyé d'Allah (pbAsl) interdit de __manger de l'oignon ou du poireau__ ; pourtant nous fûmes pousser par le besoin à en manger. Il dit alors: ''"Quiconque mange de cette plante malodorante ne doit pas se rendre à notre mosquée; car les Anges répugnent de ce que les êtres humains répugnent".''
* Il est interdit de __parler trop fort__ sur le marché de Rochefort.
**''Depuis quand les téléphones portables perturbent-ils les matériels informatiques ? (ils ne sont même plus interdits de façon systématiques dans les hôpitaux) Après enquête, il paraît qu'en fait ça dérange le concierge...''
*Au café "Le relais" à Paris 18ème dans le quartier Barbes (rue Belhomme), un panneau manuscrit barra longtemps la porte d'entrée dans les années 80, il y était indiqué en toute simplicité : Établissement interdit aux __trafiquants__.
* Dans un bistrot parisien : [http://pagesperso-orange.fr/lemomo2/Annonces/davance.jpg]
**µattention, il s'agit d'un site adulte, mais qui se distingue par son ''originalité'' et par son ''intelligence'' (ce qui est assez rare pour être signalé)µ
*__[Comme un interdit|http://240plan.ovh.net/~echolali/wiki/index.php?ListeDeParolesDeChansonsDe#interdit]__ ('' chanson de Christophe'')
ListedesMemoiresdeMax
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Stance One : Je croyais Torquemada mort et enterré, ben, non revoici son spectre puant qui me harcèle, aujourd’hui la menace, demain la question, après demain le bûcher, il me faut donc me préparer, dommage il me restait trois ou quatre choses à faire dans cette vie. [http://www.el-mundo.es/larevista/num152/imagenes/histo.jpg]
*Stance Two : l’homme est un être imparfait sinon nous n’aurions pas de verrues ! On sait comment l’univers s’est créé mais on ne sait pourquoi, on sait pas dire la vie, on ne sait pas dire l’intelligence, la physique quantique surprend, on s'interroge sur la conscience, on meurt de maladies dont on ne sait les remèdes, on obéit encore aux dieux, et moi il faudrait que je m’explique ?
*Stance Five : Des blés à l'infini, du maïs, du tournesol, du lin, la moissonneuse est immense et je la chevauche, l’homme est tout petit, il a peur, je veux le rassurer mais il se cache derrière un tronc, je lui parle mais c’est trop fort et je rend sourd le malheureux. Quel désespoir d’être un géant !
*Stance Six : Admis à l'Eden, il commença par se recoiffer. Le peigne en fer ne lui brulait pas les doigts mais lui calcinait la crâne. C'est normal, dit St Pierre, le peigne en fer, c'est l'[Enfer|ListePourVisiterlEnfer].
* Incroyable le premier animal qui rêva d’un autre animal. Monstrueux le premier vertébré qui réussit à se dresser sur deux pattes, semant la terreur parmi les bêtes qui rampaient encore normalement, avec une joyeuse et naturelle proximité, dans la fange de la Création. Ahurissants le premier coup de téléphone, la première ardeur, la première chanson, le premier cache-sexe.
* Vers les quatre heures du matin d’un quatorze juillet, Louis-Paul Vitrier, endormi dans sa haute mansarde, la porte et les fenêtres ouvertes, rêva de tout cela. Comme il s’apprêtait à se répondre lui-même, il reçut la visite, à l’intérieur du rêve, d’une figure monacale, sombre et sans visage, qui exprima ses pensées à sa place, poursuivant avec des paroles un rêve de pures images :
* Mais la raison, ni lente ni paresseuse, nous apprend que sitôt répété, l’extraordinaire devient ordinaire, de même que dès que cesse la répétition, ce qui auparavant passait pour fait commun prend figure de prodige : ramper, lancer des pigeons voyageurs, manger du gibier cru, abandonner les morts au sommet des montagnes afin que les vautours, en se nourrissant, assainissent et accomplissent le cycle naturel des fonctions.
** "Incroyable le premier animal qui rêva d’un autre animal. Monstreux le premier vertébré qui réussit à se dresser sur deux pattes, semant la terreur parmi les bêtes qui rampaient encore normalement, avec une joyeuse et naturelle proximité, dans la fange de la Création. Ahurissants le premier coup de téléphone, la première ardeur, la première chanson, le premier cache-sexe.
**Vers les quatre heures du matin d’un quatorze juillet, Pollo Phèbe, endormi dans sa haute mansarde, la porte et les fenêtres ouvertes, rêva de tout cela. Comme il s’apprêtait à se répondre lui-même, il reçut la visite, à l’intérieur du rêve, d’une figure monacale, sombre et sans visage, qui exprima ses pensées à sa place, poursuivant avec des paroles un rêve de pures images :
**- Mais la raison, ni lente ni paresseuse, nous apprend que sitôt répété, l’extraordinaire devient ordinaire, de même que dès que cesse la répétition, ce qui auparavant passait pour fait commun prend figure de prodige : ramper, lancer des pigeons voyageurs, manger du gibier cru, abandonner les morts au sommet des montagnes afin que les vautours, en se nourrissant, assainissent et accomplissent le cycle naturel des fonctions.
* Je lui en ai parlé...il ne s'en souvient plus !
* et avant hier, on n'en parle pas, hein !!
*Ben oui, au départ, cette liste était vide...Ça vous étonne ?
ListeDeQuand
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Quand le vent soufflera (je repartira)
* Quand %%Link(les parents boivent,http://www.museedelapub.org/virt/affi/villemot/graphics/villemotdia02.jpg)%%..
* Quand on a que l'amour à offrir en partage
* Quand tu me prends dans tes bras, tu me parles tout bas
ListeDeDeserts
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
/*[http://www.deh.gov.au/parks/nrs/ibra/version4-0/photos/images/gsd2.jpg]
/*[http://www.deh.gov.au/parks/nrs/ibra/version4-0/photos/images/tan2.jpg]
* Vermilion Cliffs - Utah (seules dix personnes par jour, ayant réservé six mois à l'avance, sont autorisées à s'y rendre)[http://p.webshots.com/ProThumbs/28/24328_poster405.jpg]
* Désert : Endroit où l'on récolte du pétrole - ''Jean-Charles - Extrait du recueil de paroles d'élèves - La foire aux cancres''
* Le désert vécu par l'étudiant pendant un cours en amphi
* Paris au mois d'août
ListeCacadoie
/* par PITIE ne mettez pas de liens vers de GROS cacas d'oies. merci
**caca d'oie : invariable. Jaune sale verdâtre. (connotation péjorative) Fait partie du champ chromatique jaune. Code couleur = CDCD0D
***avoir une moquette caca-d'oie est d'un très mauvais goût, mais cela permet de ne pas être envahi par les piques assiettes.
[http://innovalo.scola.ac-paris.fr/PAI5/oie.ht22.gif]
ListeDePremieresPhrasesDeRomansQueJaime
* Ai-je été nourri par ma mère ? ''Jules Vallès'' __L'enfant__
* En 1517, le Père Bartholomé De Las Casas eut une très grande pitié des indiens qui périssaient dans les laborieux enfers des mines d'or antillaises. ''J-L Borgès'' __Histoire de l'infamie__
* Il y avait d'abord ce visage allongé par quelques rides verticales, telles des cicatrices creusées par de lointaines insomnies, un visage mal rasé, travaillé par le temps. ''Tahar Ben Jelloun'' __L'enfant de sable__
* Sable à perte de vue, entre les dernières collines et la mer - la mer - dans l'air froid d'un après-midi presque terminé, et béni par le vent qui souffle toujours du nord. ''Alessandro Baricco'' __Océan mer__
* Adeline Serpillon appartenait à cette écrasante majorité des mortels qu'on n'assassine pratiquement pas. ''Pierre Desproges'' __Des femmes qui tombent__
* C'était pendant les jours de la "peste" de Naples. ''Curzio Malaparte'' __La peau__
* C'était un mardi soir de novembre. La Canebière ronflait par une nuit morne. ''François Thomazeau'' __Qui a tué Monsieur Cul ?__ - µ(Oh la tricheuse, il y a encore __deux__ phrases !) %%Green(cf supra)%%µ
* La voix féminine tombe du haut-parleur, légère et prometteuse comme une voile de mariée. ''D. Pennac'' __Au bonheur des ogres__
* Elle a une bouche sans lèvres et un long nez, ses yeux sont des fentes avec deux points noirs entre les fentes, sa peau est pâle, ses cheveux sont roux, ses seins sont énormes, elle dit "plusieurs kilos et c'est pas marrant pour mon dos, ça tire sur les omoplates". ''D. Belloc'' __Le Petit Parmentier__
* L'idée que je me faisais de lui était celle d'un homme ordinaire au caractère facile, dépourvu de méchanceté, celles d'un homme sans qualités particulières. ''André Brink'' __Une saison blanche et sèche__
* Je suis composé d'eau. Personne en peut s'en apercevoir, parce qu'elle est contenue à l'intérieur. ''Philip K Dick'' __Confessions d'un barjo__
* Quel est le sens de ces paroles...de ces paroles ? ''Thomas Mann'' __Les Buddenbrook__
* Lorsque, à seize ans, le jeune Karl Rossmann, que ses pauvres parents envoyaient en exil parce qu'une bonne l'avait séduit et rendu père, entra dans le port de New York sur le bateau déjà plus lent, la statue de la liberté, qu'il observait depuis longtemps, lui apparut dans un sursaut de lumière. ''Kafka'' __L'Amérique__
* Il arrêta sa voiture dans une rue écartée et s'assura avec une apparente nonchalance que personne ne l'avait suivi. ''Gilbert Cesbron'' __C'est Mozart qu'on assassine__
* Mon récit sera rapide, comme l'ange de la mort lorsqu'il surgit par la fenêtre ou par la fente sous la porte, s'empare de l'âme du pire des tyrans et disparait aussitôt par le même chemin en emportant l'âme d'un poète. ''Ali Erfan'' __Le dernier poète du monde__
* Tu vois, ma bonne amie, que je tiens parole, et que les bonnets et les pompons ne prennent pas tout mon temps; il m'en restera toujours pour toi. ''Choderlos de Laclos'' __Les Liaisons dangereuses__
* Cette histoire, c'est bribe par bribe, et de diverses bouches, que je l'ai recueillie ''Ethan Frome '' __ Edith Wharton__
* En histoire, le mensonge est l'activité la mieux partagée. ( Les mensonges de l'histoire - __Pierre Miquel__)
* Cette nuit-là, un personnage anonyme et invisible vint lui parler de Swift. (Swiftitudes - __Estelle Lemaître__)
* Il y a quatre ans qu'à mon retour de la Terre-Sainte, j'achetai près du hameau d'Aulnay, dans le voisinage de Sceaux et de Chatenay, une maison de jardinier, cachée parmi des collines couvertes de bois (Mémoires d'Outre-Tombe (__Chateaubriand__)
* Le soleil apparaît dans un des coins supérieurs du rectangle, le coin gauche pour le spectateur, l'astre-roi représente une tête d'homme........(L'évangile selon Jésus-Christ - __José Saramago__)
* Une fois de plus, Chen, inspecteur principal de la police criminelle de Shanghai, reprenait, dans la brume du petit matin, la direction du parc du Bund (Visa pour Shanghai - __Qiu Xiaolong__)
* Cette nuit là, un personnage anonyme et invisible vint lui parler de Swift (Swiftitudes - Estelle Lemaitre)
Anne S. - complété par Liliane G. de Margency et Thibault C., un nouveau- ainsi que par divers autres intervenants; c'est un ''wiki'', quoi...
ListeDeDefinitionsDeMotsCroises
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
19 Trahi par l'extrême-gauche (2 lettres)
31 Je commence par un "e", je finis par un "e" et je contiens une lettre (9 lettres)
38 Prélude à une partie de billard (10 lettres)
N°1 : République ? µµ Parliament ? bicamérale ?µµ%%%
N°30 : u parce que u rit noir (je n'y connais rien en mots croisés, mais ce truc est surjoué dans les charades à tiroirs)%%%
ListeDaout
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Paris Plage
*Tous les plombiers sont partis à l'île de Ré
* La nuit du 4 août, où l'on a aboli les privilèges (enfin, il paraît...)
** La mi-août (à la mi-août, les chats partent en vacances, c'est bien connu)
***µ''Jean-Marie Assomption présenta le 15 août 666 au pape Vitalien un modèle d'engin élévateur baptisé l'assompteur. Ce modèle était en concurrence avec un prototype présenté par Bruno Ascension le 6 juin 666 (l'ascenseur). C'est ce dernier qui emporta le marché... mais par superstition la date de célébration de l'évènement est resté mobile. Quant à l'assompteur il n'a été utilisé qu'une seule fois... par la vierge Marie. (source : "les vrais secrets du Vatican d'il y a bien longtemps")''µ
**Napoléon III avait tenté d'instaurer le 15 août, la St Napoléon (Bonaparte étant né un 15 août)
* Le 16 août 1977 disparaissait Elvis Presley (overdose de beurre de cacahouètes). Mais est-il bien mort ?
* 30 août: Jour de la St Fiacre ! Bonne fête (s'il y en a) aux Fiacre, aux Fiacrette et aux Fiacrine... Mais St Fiacre est aussi le Saint Patron des jardiniers, des maraîchers, des fleuristes et des potagers... et donc aussi des outils qui vont avec, il est donc à ce titre le saint patron des râteaux. Le 30 août fêtons tous nos [rateaux|ListeDeRateaux] de plus la date s'y prête bien parce qu'en vacances on s'en ramasse pas mal :-)''
__µµ%%Center (Georges Brougnard surpris par un paparrazzi)%% µµ__
**''Parce que c'est le mois des amours de vacances et qu'il ne faut pas oublier sa tite capote...''
µµListe démarrée par [Sergio|http://leserged.online.fr]µµ
ListeDeFormesdYeux
* Les yeux bleus vont aux cieux, les yeux gris au paradis, les yeux verts en enfer, les yeux noirs au purgatoire, les yeux marrons au boxon.
***ben si ça revient... tu parles d'un progrès...
ListeDeProduitsPerissablesEtNonComestiblesTrouvablesAuSuperMarche
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Dentifrice µµpar bonheur, si, le dentifrice est comestible...µµ [http://www2004.free.fr/carte-pub/dentifrice-oriental.jpg]
*[Vigile|ListeDePapes] µµc'est comestible !µµ[http://home.nordnet.fr/~caparisot/images/vigile.jpg]
ListeDeNumerosDePortablesDeGensQueJeNeConnaisPas
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* 06-12-34-66-21 (le numéro de mon premier portable, euh, pardon, le numéro premier de mon portable...)
* Allo, Inv 39-45 ? Ah, non ! Ici c'est Inv 14-18, son père à l'appareil.
ListedeCommeDirait
* ''Ah, t'as été te séparer du meilleur de toi-même'', comme me disait mon grand-père en me voyant sortir des cagoinces - µet étonnez-vous après ça que j'aie mal tourné !µ
* ''C'est toujours les meilleurs qui s'en vont'', comme disait mon grand-père en partant
* ''Ça me fait une belle jambe'', comme disait Guillaume Depardieu [http://www.creps-strasbourg.jeunesse-sports.gouv.fr/articulation/spectacles/jambe.gif]
* ''Comme dirait Zazie'', chanté par Jehan Jonas
* ''En passant par la Lauren'' comme disait Humphrey Bogart
**µrepris plus tard par le bourgmestre de Sofia (Bulgarie)µ
* ''Et maintenant tu te parfumes pour aller à l'ANPE ?'', comme disait Latifa à Mamadou qui allait vraisemblablement au douzième bureau.
* ''Le scoutisme, c'est des couillons habillés comme des gamins qui emmerdent des gamins habillés comme des couillons'', comme dirait en substance un humoriste que je ne parviens à retrouver (µMarcel Gotlib ?µ)
* ''Même avec septante-sept demis dessus, c'est encore un monde de merde'', comme dirait Sam, qui paraît s'y connaître
* ''Mieux vaut faire envie que pitié'', comme dirait Georgette
* ''Ote-toi de là que je m'humecte !'', comme dirait Gérard Depardieu
* ''Passe-moi la lupara'', comme dirait Gio de Calabre
* ''Si vous roulez vers un feu rouge à 60 000 kilomètres par seconde, vous le verrez vert'', comme dirait Doppler
*Liste proposée et initialisée par S. (par 40° sous le [casque|http://www.bigoudi.net/big3.php])
ListeDeListesPolyglottes
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListeDeNationalites
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeTautologies
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListedUchronies
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* uchronie : néologisme formé par le philosophe Charles Renouvier en 1857 et illustré dans son ouvrage révisé en 1876, "Uchronie, l’utopie dans l’Histoire." Une __Uchronie__ est un récit se déroulant dans un univers dont l'histoire à dévié par rapport à la notre
** ''20 ans après la victoire des nazis contre les alliés, Hitler fête son anniversaire en 1964 dans le Berlin conçu par Albert Speer. Un policier mène une enquête sur un meurtre qui va l'amener sur une vérité dissimulée et oubliée, la disparition des juifs d'Europe.''
**''Hitler vit aux etats-Unis et est atteint de la maladie de Parkinson...''
** ''Adolf Hitler émigra en 1919, aux États-Unis. Illustrateur de talent, il collabora au magazine Amazing Stories où il se fit remarquer par ses couvertures toniques et colorées...''
** Hitler, Goebbels, Goering et Borman sont tués dans un attentat commis dans un cinéma parisien.
µµListe inspirée à JoZgur par Philip K. Dick et Robert Harrisµµ
ListeDeCeQueJauraisPuMais
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* J'aurais pu mettre Paris en bouteilles mais je n'avais pas de si.
* J'aurais pu pouvoir, mais je n'ai pas su ''Eugène S. Les mystères de Paris''
* Enfin, j'aurais pu ne pas disparaître, mais je suis magicien, on ne se refait pas, on naît comme on est, ou plutôt, on est comme on naît, enfin, bref... pouf ! Et re-pouf !!! Et pouf de vrai. ... %%Smiley(clap2)%% ... %%Smiley(wave2)%%
ListeDesPokemonsRouges
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeNotes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
µListe créée par El Jjµ
ListeDeCocus
/* par PITIE ne mettez pas de liens vers de GROS cocus. merci
* Candaulisme : le mot a été formé d'après le roi Candaule qui fut le premier cocu heureux de l'histoire. Il prenait plaisir à voir sa femme désirée (et honorée) par d'autres, mais exigeait que ce soit en sa présence. Le candaulisme est donc le fait de retirer du plaisir de voir ''(il doit être présent)'' son/sa partenaire avoir des relations sexuelles avec un tiers.
** on trouve parfois par erreur l'expression caudalisme à la place de candaulisme, amusant parce que fabriqué avec la racine "caudal" qui signifie "se rapportant à la queue".
* Cocu : Se dit de celui qui partage un cul.
* Cocu : Un entier qui partage sa moitié avec un tiers. ''Alphonse Allais''
* Vulcaniser : Ce terme a d'abord été un synonyme de cocufier. "Les friponnes qui vulcanisent leurs époux ne cessent de les baiser, comme Vulcain, époux de Vénus, cocufié par Mars". Aujourd'hui il s'agît plutôt d'un procédé industriel permettant une meilleure utilisation du caoutchouc, ce procédé est à la base de la fabrication des préservatifs modernes (comme quoi on est pas si loin du sujet)
* Julien par Sandrine (et plein de fois en plus ! elle en redemande encore aujourd'hui la cochonne ! mais il a pardonné. Amen...)
* Vulcain : (chez les Grecs Héphaïstos) : Deuxième fils de Jupiter et de Junon. Il est très laid, et en plus il est boiteux car quand Junon a vu son visage, elle a été tellement dégoûtée qu'elle l'a jeté du haut de l'Olympe, et ses os se sont cassés et mal ressoudés. Il a été élevé par des nymphes et est venu ensuite dans l'Olympe, où son habilité aux travaux de la forge l'a fait nommer dieu du feu. Il a réussi à épouser Vénus à la suite de magouilles devenant cocu pour l'éternité.
* Le Roi Ménélas (dans l'Iliade d'Homère) Roi de Sparte, marié à Hélène, il sera cocufié par le Prince de Troie, Paris, déguisé en berger. Cela déclanchera la Guerre de Troie. En 1864, Jacques Offenbach repris le thème dans son célèbre et brillant opéra bouffe, la Belle Hélène.
* Raimu dans "la femme du boulanger" de Jean Giono adapté au cinéma par Marcel Pagnol (1938) puis au théâtre par Jérôme Savary (1985), puis par Alain Sachs. (2010 et 2012)
* Cocu de par la loi
* Cocu par antidate ou de précession
* Cocu par conviction
* Cocu par défi
* Cocu par nécessité
* Cocu vengé par un chat [http://pagesperso-orange.fr/lemomo2/Cocu07.jpg]
* Elle a un mari trop serin pour ne pas le faire cocu ... ''Emile Zola, le ventre de Paris, édition de 1873, p. 678''
* J'ai fini par m'apercevoir que je n'étais plus le seul à partager la fidélité de mon épouse. ''Eugène Labiche''
* J'ai souvent remarqué, pour ma part, que les cocus épousaient de préférences des femmes adultères. ''Alphonse Allais''
* La plus belle mort, c'est d'être tué à 80 ans d'un coup de revolver par un mari jaloux. ''Victor Hugo''
* On devrait faire la journée des Cocus, tout le monde s'échangerait des cadeaux comme à Noël. ''Jean Yanne, et plagié par Ruquier''
* On ne dit plus il est cocu, mais il est ''préoccupé par des problèmes conjugaux''
* Pour le cocu honteux, sa femme est une salope et la plupart du temps cette situation engendre le divorce. le candauliste voit les choses autrement : Si sa femme le trompe c'est parce qu'elle est belle est désirable, elle a des tas d'amants, mais lui a l'immense chance d'être son mari. Certains candauliste vivent aussi leur situation avec un certain masochisme, la situation leur fait mal, mais leur femme restent leur femme et c'est pour eux la plus belle des récompenses.
* Kiki était cocotte et Koko concasseur de cacao. Kiki la cocotte aimait beaucoup Koko le concasseur de cacao. Or le marquis caracolant, conquis par les coquets cacas de Kiki, la cocotte, offrit à Kiki la cocotte un coquet caraco kaki à col de caracul. Quand Koko, le concasseur de cacao, s'aperçut que Kiki, la cocotte, avait reçu du marquis caracolant un coquet caraco kaki à col de caracul, Koko conclut: "Je clos mon caquet, je suis concasseur cocu".
*"Mais qu'est-ce que ça peut nous foutre que ce soit de ta faute, pauv' con ? Fallait pas nous emmener là. On est dans la merde à cause de toi, et tout ce que tu trouves à faire, t'es juste bon à te lamenter sur ton sort. T'as rien dans le bide. T'es bon à être le larbin de ta femme, c'est tout ce que t'es bon, pauv' con ! On est dans la merde, Gigi elle nous l'a dit, hein, on va tous crever là, on est dans la merde à cause de toi parce que t'es qu'un con, et puis t'es cocu, t'es cocu, et t'en redemandes" ''(Jugnot, à Lhermitte dans les Bronzés)''
ListeDeNusCouchesDansLaSculpture
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
*__Antonio Canova__, Pauline Bonaparte/Borghese en Vénus triomphante, 1804-1808[http://www.cyberpresse.ca/images/bizphotos/924x615/200805/16/282956-sculpture-canova-pauline-borghese-devenue.jpg]%%Center(même que son mec à Pauline, il ne voulait pas que les hommes puissent voir la sculpture de sa femme tellement il avait peur que l'émotion érotique ne se substitue à une bien légitime émotion esthétique.)%%
*__Auguste Clésinger__ : Femme piquée par un serpent[http://www.cineclubdecaen.com/peinture/peintres/clesinger/femmepiqueeparunserpent.jpg]%%Center(une autre vue)%%[http://www.crashboombang.net/wp-content/uploads/2010/03/Musee_dOrsay_205_Clesinger_Femme_Piquee_par_un_Serpent_2008.jpg]
%%Center(µµAaaah d'accord, bien vu, et merci pour cette participation objective et pertinente, objection retenue.µµ)%%
Commentaires (voilà-voilà, vous êtes bien entendu tout à fait autorisés à vérifier par vous-même si je n'ai pas raconté des conneries et à venir me cyber-souffler dans les bronches)
ListeDebOonnesActricesFactices
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeToutCeQueVousAvezToujoursVouluSavoirSurLaBirmanieSansJamaisAvoirOseLeDemander
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Droit de vote : la liberté religieuse est garantie par la Constitution, mais le droit de vote est interdit aux religieux.
*** Script : L'héroïne (Catherine Hepburn) en consomme. Elle rencontre un guide birman (Humphrey Bogart) sur un pont. Malheureusement elle doit rentrer chez elle, pour arroser ses rhododendrons. Dans sa fuite panique, elle lui lance un long au-revoir 'nous nous écrirons'. Mais les sévices postaux ne fonctionnent plus, pour cause de guerre mondiale, et il ne répond pas à ses mails. Désespérée, elle tente de se suicider en mangeant des moules-frites. Un jeune médecin (Gary Grant) du CHU le plus proche la sauve, et finira pas l'épouser. Ensuite ils divorceront. Il lui versera une pension alimentaire qu'elle convertira en bons du Trésor. Le guide birman (Humphrey Bogart) vendra chèrement sa vie en combattant les lanciers du Bengale. Enfin, 10 euros. Les lanciers lui rachètent sa vie, et, pour racheter sa conduite passée, il finit comme G.O au club-med de Rangoon. On notera l'émouvante apparition de Lauren Bacall, barmaid lymphatique, dans la scène de l’hôtel. L'épisode de la poursuite en 4X4 semble avoir été ajouté après la fin du tournage, à la demande de certains [sponsors|http://www.chez.com/brougnard]. Il n'apporte que peu de choses au film, qui est nul, de toutes façons ([Télérama|http://multimedia.telerama.fr/edito/anneaux/liste_anneaux.asp?id_anneau=1#])
µ Crée à l'origine par El Jj -- modifié par Msblast (virus)µ
AmourDesListesEtOrguesDeuxBis
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Green(Sur la minuscule scène du Bar des Amis, Joseph Pujol µµLe Pétomaneuµµ venait de faire son apparition. Un tonnerre d'applaudissements le salua. Puis le tonnerre cessa. C'est alors que le fondement de Joseph put enfin commencer à servir...)%%
Il prit son courage à deux mains - si vous le voulez bien µ(si en revanche vous ne le voulez pas, c'est par [là|AmourDesListesEtOrguesDeuxBisBis])µ - tourna le dos à la salle où ses amis s'époumonaient, s'accroupit... Le silence se fit; chacun retint son souffle; les mouches même suspendaient leur vol; seul un filet d'eau - agaçant - coulait d'un robinet au joint perclus de rouille.
...le plus formidable pet que la terre ait jamais subi jaillit de son fondement torturé ; la plus étonnante flatulosité dont l'univers jamais ne retentit, s'exprima, hurlement titanesque, des entrailles boursouflées et incandescentes de l'artistique génie. µ(Ce fut son chant du cygne : ensuite, mais bien plus tard, il ne péta plus, et mourut.)µ Un silence s'ensuivit ; un silence qui était encore du Pujol. L'eau du robinet au joint perclus de rouille, avait enfin fini de couler. Les mouches avaient enfin fini de suspendre leur vol : elles étaient mortes. Chacun, par précaution, continuait à retenir son souffle. (Beaucoup moururent).
ListeDuSavoirParlerJeune
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!!%%Center(Liste du savoir parler jeune)%%
*Arrache : pp. À l'~ . Sans préparation. ça ~ : C'est fort (épicé)
*%%Blue([Bahut|ListeDeBahuts])%% : nm. 1. École. 2. Camion. (Il parqua son bahut sur le parking du bahut). Attention : ne pas confondre avec ['Dahu'|ListeDeDahus] : Animal alpestre asymétrique.
*Boîte à caca : nf. Anus (par métonymie)
*%%Blue(Casser)%% (se) : v. Partir
*Darons : n. Parents
*%%Blue(Filer)%% : v. 1. Partir 2. Donner
*%%Blue(Pétard)%% : nm. 1. Joint de cannabis. 2. Cul, en parlant d'une dame. 3. Arme de poing.
*%%Blue(Squatter)%% : v. 1. Être dans un endroit sans l'accord ou la volonté du propriétaire. 2. Être quelque part : Squatter un banc.
Ne convient pas (ce n'est pas du parler jeune, c'est du parler tout le monde !
µEuh, là, y'en a plein, on les employait déjà quand j'étais djeun (c'est à dire il y a quelques dizaines de piges) %%Blue(en bleu)%% -- ben oui, c'est du parler jeune des années 1940, 1960, 1980, 80, 2000. un mix. -- pourquoi tant d'anus ? --µ µ%%Red(On pourrait rajouter alors [ce dictionnaire|http://www.miscellanees.com/s/somaize.htm])%% -- super ce dictionnaire, vachtement bath! µ%%%
Tenez, pour les djeuns qui croient avoir inventé le verlan, une chanson de Dutronc dans les années 60 [J'avais la velcer qui zéfait des gueva|http://leserged.online.fr/music/jacques%2520dutronc-j'avais%2520la%2520vellecer%2520qui%2520zefait%2520des%2520gueva.ogg]. µµPas trouvé les paroles sur le net, alors j'ai mis un Oggµµ
* ListePourParlerJeune
µCréée à l'origine par El Jjµ, µµrestaurée et remise en page par eiki le 13/11/08 - d'ailleurs quand c'est créée, c'est souvent à l'origine...µµ
ListeDesChosesContreMesMurs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Un plan touristique de la ville de Québec (édité par l'auberge de jeunesse)
*** South park
* Une porte menant vers le reste de l'appart'
* un porte-parapluies
ListedActesPasCoolSurCeWiki
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# C'est pas cool de croire qu'on est seul à savoir ce qui intéresse les gens, de le dire avec agressivité et de ne pas supporter ceux qui ne sont pas d'accord avec ça. /** Entièrement d'accord avec vous (voir d'ailleurs votre impressionnant catalogue de réflexions forts pacifiques en ce sens sur la télé, la politique, le football...) Je crois qu'on joue Tartuffe en ce moment à Paris... Et puis reparler de tout ça plusieurs jours après, et toujours et encore... c'est à peine croyable ! En psychanalyse ça s'appelle "avoir l'esprit de l'escalier"... et on essaie de soigner avec des neuroleptiques... /** Vous devez vous tromper de crèmerie. Je n'ai pas de catalogue de réflexions sur le foot, la télé ou la politique. Quant aux neuroleptiques, laissons-les aux vrais malades.
#%%Blue(C'est pas cool de modifier une liste, puis pour empêcher de voir quelle est la modif, d'aller se reconnecter sur l'ordinateur du gamin (avec un autre IP) et refaire pardessus une modif "vide")%% µµ('tain, c'est tordu ! -- et puis il faut investir: un gamin, un ordinateur, un réseau local...)µµ /** %%Green(µµsans dèc', y en a qui font ça ?!µµ)%%
*La ListeDeMotsRecherchesDansCeWiki a été piratée, et on ne peut plus y accéder, si les informaticiens pouvaient se pencher sur le problème... Merci !! Merci pour le "débugage", __mais si on pouvait avoir le contenu, comme avant...,__ là, cela serait parfait ! Y'a grève des techniciens ?
ListeDeChosesDouces
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [Douce nuit, sainte nuit...|http://www.paroles.net/chansons/14101.htm]
* Une parade [http://upload.wikimedia.org/wikipedia/en/c/ce/The_Doors_-_The_Soft_Parade.jpg]
* [Violence|http://www.hallyday.com.fr/Paroles/D/doucviol.html] :-)
ListeDuJeuDelOie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!!%%Center([Départ|http://www.echolalie.com/joie])%%
* cliquer sur les dés (ou appuyez sur une touche) pour les lancer ou les arréter, ou attendre qu'ils s'arrètent tout seul. On peut [[DOUBLER] pour le coup suivant. Il faut arriver sur la case __69__, ou la dépasser. Si on joue un double, on rejoue : le nombre de tours n'est pas modifié. Le [[Score] est enregistré en fin de partie.
Bientôt un [nouveau jeu|http://www.echolalie.org/wiki/index.php?ListeEchoPoly] offert par Echolaliste
ListeDePhrasesIndicibles
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Yruogyoaouv, aex ocausoumeu rma uparooya ubogniqu fukmparna vuboa, tutalu ehi ruiakbeku hequ wfav vyrp Tuudco Suxucgakmu, ras baa cobynrmotu wunauhuray!
* Kaq rwu paruakifoee ituuurooiubu uauhouq tufauka Buuougru cshoeiqu jamaateueft givbelareguz iac uouhukacomog hiutoupuos esyu xouvyfru deiak imy ydokautafo bayajoregeuo cuc.
* Xgo Noufmagkgty gomuhu gok dfa mow qurotmorunmu Gitpse nunemudooma gou aao, parotdfut uopuffuco rounetod xopufuyc qurubaorpahu prpkyb uak pogeoecaoma nim.
* Bquguuroo ram, nolupar pygoqu ofypeopolpu upu jafy puyhuuu habysycuef nur gut aegouu qum fug Uufutotov dohapwu foo wucupa Porruu texbojauu.
* Ouf gonog Huhof ffokeaiu ahe anuy, myjouvvat bqu paraorubu tupu Yocucuaag kysy tuqugu duu zufsyipi axulgity mousuorih, fiofi, jurua unmuisunt.
* Sotuvautuoni pse kavypyoymequ Aroqupameaov nofupunaodul uayufau loevuh fogobxuho aducufunuhu hapaodiqumoa lab bau pofygpauuguu soeubuirucu gmugalaex hotae rrh japusupul fparyuptsue bodic.
* Vou, ffobg rghaguhuf taa tuf hubupa comuckyu xoe kma, gudquhuhe humiumaparu rumukupof gaudahi oau fag tatohouurmuv omim tfu rarohoquccle mao.
* Dno garbuh Ftoomigvqu onukequva fogartyc kihamupefo ygo paru bau moh abo Oruxuoeu akd uce tnuuorhe goh nodovb ooh kip Ponhefyu!
* Cut gow aoguunnhudc tybypoqubaya uobicupptlu yebduiup qukgopo fugfueg Uimufor soh hekyokueb ehuqu ugi par pofumauf gezo, uoromuuky tudukaq ufu Taguumru.
* Dof gutibuodio oyrarupotkau quthueunh lal hahoagatuat wepquurgrue nquwuvueoaoc Tuulapuupo gae cou qud pue baf jaugypagu haooo rbothuhu kyseagugh parog perfummybavu.
* Ueeiythyag fiusaulaouja gaqugetuaa tyqu goposquxat nus Tyheh azoaaabahu gaaytadurup suockuouit Hiragrah umega kapupukrus bparosot, hyv equ ichit baeir Natys guu!
* Huh tna fifm boun gahyr ihuniquho jba, oam Cauuvdypu pgayusuq supar tuginauueo ktimiput, fotu, tbvi jepuquoto fut nehuadufgyk phuuaquh goq.
* Yca Fukcyahahi rur par fuk puouuwoahu hyuu pbu atubsaq jau, eumomuah popufyo puootoepu bum gob Nogoepquequs Uoauaka, kud syuhafap kacu.
* Bocularohife duuyeuuyuoh fuqu mus yyh jui ojukafeo ubsuocetgnu cjoququeg axuuobophaos ucx ruumatapar puu mea dyu rougku gguf cumpgak pof guo!
* Mumuzxiokefg hufubguw yhacra kotouvuoto ddbrufunoys gou uhomiibkkolf dop gso jay Bukes, huousulursha rup pvowhoaquivu uaudaeum, par atari tilu lomugy ookhobusu!
* Vahagecinato bueitupugki qulutajsu poa aoapxu mbovaxitauh Govuyaj gac fam nefoax aha namearhihor, hapa upomafutwur vooousojfo hofafapaequ bufaqusaewug tad quwobmquuu baffumparm.
* Cuoiruduuzy hib xrocohuo qupubyt, Neparufao opoyd gyy krunoconuq yje psa Vyyuiavfu geaxugufavha pui orf macgku sazu daelmihusuu ofys, loce, pui.
* Bugecoutu haeujoryq, cag upuu spar urkr puu fogua owo ydaeuquaoo guf, cuqugoutu aqua xfu quoqunigaoo jubyy, gom ofebadiqu uau, foniuou.
* Pfypefi futu puuuymra Tacpvunuh fipyte quryparu Auouolyhuny, upaucapo ura puus rauyzuuvi fyv, qucyuof qukunmuh susofi, kiuq dwa gsy cetu hagugunysug.
* Put aukuluug ofut unrer woauonua jumu vyloahiuguda, pvnuxeu, pom pss pufgbaug peoparowrhu, quh kaag, faqu Snoryup Waugehuhex veuzooha mgahatarnu hahobxf.
* Gomqubog guip gig srurou ful fis itorugep guno maa rguo mtookava qud gab roq Tiuseygud upk par Oruthato roquood kapmqufumup.
* Qug catuegaae Huifuuum, tag fidriof quliigosy yorl aaam wrc kefyu duiqu roy uho nogyhuno anah Giieboaaju aatyyko tutduq hunuoro par.
* Aqu fjuaosatum fudom raa piwahowsuh ssurquuluw puodeupuph fuf suvyhuuga hol sutgubueo, nob coawahuparu gopiib rup ooh apoug sab, duao hywujauotuno.
Inséré par Echoblast (TM), le virus d'Echolalie.
ListedEchos
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeManieresDeSavoirQuIlFautChangerDeDentiste
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Il vous arrache une dent par mois depuis 2 ans et 8 mois
* Il vous raconte sa partie de chasse du dimanche précédent
* Son assistante (son épouse ?) a au moins 60 ans et des bigoudis sur la tête, vous semblez la déranger, mais elle vous laisse entrer quand même, le Paris-Match que vous feuilletez en salle d'attente date de plusieurs années, enfin le dentiste vient vous chercher, c'est un vieillard affable en robe de chambre, son équipement date apparemment des films d'espionnage des années 1950, il met juste ses doigts dans votre bouche et vous dit : "Oh, là là, elle est foutue, plus rien à faire, il faut l'arracher, je vous donne l'adresse d'une clinique qui va vous opérer, ne vous inquiétez pas : elle est conventionnée..."
µListe créée par El Jjµ - C'était qui ce "Moi" qui s'est dit créateur de cette liste?
ListeDeCoups
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* __3.Fb5!__ début de la partie espagnole aux échecs
* coup de martinet [http://www.country-liberal-party.com/images/Clare-Martinet-sm.jpg]
* coup de parapluie
* coup de [torchon|http://www.lumiere.org/realisateurs/tavernier-bertrand-partie4.html]
* coup du parapluie
* coup tôt tiré (par un éjaculateur précoce)
%%Blue(''idée de JT, Jef, Adèle et Sol (µvenue tout d'un coup, sous le coup de l'inspiration, sur le coup de 23h30µ.)'')%% Une sorte de partouze intellectuelle, en quelque sorte ! %%Red(''lol, oui ! et comme on voit, de haut niveau !!'')%%
ListeDesPiresCauchemars
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** quelqu'un a fait plein de graffitis obscènes sur les listes pendant la nuit (par ex, une ListeDePhraseJamaisPrononceesParNapoleon)
** Se faire pénétrer par un virus
** Echolalie se fait infiltrer par les témoins de Jehovah
** la parution des ''Révélations'' d'Ernestine Chasseboeuf : "Georges Brougnard est gérontophile, j'ai les preuves!"
** les parents [http://3.bp.blogspot.com/_vW8FXbVhlic/TKTwiGXAqQI/AAAAAAAARfA/WI-nrQXc2uI/s400/blog+-fun+-violence+scolaire-IPR_Charb.jpg]
*** __les parents__
** Participer à une AG d'Echolalie
** être harcelé par le Secrétariat
ListeDePhrasesJamaisPrononceesParNapoleon
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!!%%Center(Liste de phrases jamais prononcées par Napoléon)%%
* Ce n'est pas parce que le renard se met des plumes qu'il devient une poule
µListe créée par El Jjµ
ListeDePhrasesContraintes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
(Ils jappent, kératinisent les métaphoriques nitrosomas.) Oh ! Paronyme quincaille ! Raccrochez stoïquement tout uniforme ! Vacillez, wisigoths xylographiques, yaourtières zététiques ! (1)
** Assez, Bérénice. Circule ! Des érotomanes folles, graves, heureusement illuminées , hystériques, képi le montrant , nasillent. Oui, parce que Rémi, sans tergiverser, ulule vaillamment : "Walkyrie xénophobe !... (à suivre)
** Avance, Baby ! Ces dames énervées font galoper Henry Irving : jeux kilométrique longitudinal mesurée nocturnement où passent quelques riches salopards tentés usuellement vers Wagram. Xavier-Yvon Zaparreto (2)
Partie automatique :
# Guy Debord, ''Œuvres cinématographiques complètes'', éd.Gallimard (et Virgile, déjà entendu parler?)
ListeDeVraiOuFaux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# L'épargne est la part du revenu disponible qui n'est pas consommée.
# Le budget de l'Etat est financé pour l'essentiel par les impôts et les taxes.
# Le parlement belge siège à Strasbourg
# Le Parlement européen siège à Bruxelles
# Le premier sponsor du Paris St Germain était une marque de purée de petits pois
# Le prix du marché est un prix fixé par les producteurs.
# Les chômeurs font partie de la population active.
# Les corbeaux sont en voie de disparition
# Les dinosaures étaient des ovipares (pondaient des œufs).
ListeDeFestivalsCinematographiques
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Festival du film scout à Paris (je crois)
Liste montée dans les marches par JoZgur
ListeDeTchinTchin
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
ListeDeCeQuiNarriveQuAuCinema
/* par PITIE ne mettez pas de liens vers de GROS films. merci
*Au 20e siècle il est parfaitement possible de tirer et d'atteindre des cibles hors de portée visuelle ; les gens du 23e siècle auront perdu cette technologie.
**Dans ce cas elle ne se sèche jamais devant un radiateur, mais enroulée dans un drap de bain devant le feu de bois d'une immense cheminée, style château médiéval. (Scène bien utile au héros pour parvenir à séduire l'héroïne).
*La majorité des gens gardent un album rempli de coupures de journaux, particulièrement si un membre de leur famille est mort dans un étrange accident de bateau.
*La Tour Eiffel est visible depuis toutes les fenêtres de Paris.[http://www.affichescinema.com/insc_t/touche.jpg]
**Et les vaisseaux spatiaux brûlent particulièrement bien...
*Le système de ventilation de n'importe quel bâtiment est le parfait endroit pour se cacher. Là, personne ne pensera à vous trouver et en plus vous pourrez accéder à toutes les pièces de l'édifice sans aucun problème.
*Les animaux parlent à voix haute et dans la langue du spectateur entre eux et quelques fois aux petits enfants qui-les-comprennent-parce-qu'ils-sont-sensible-et-rejetés !
*Les bureaux de police font passer à tous leurs officiers des tests de personnalité afin d'être sûr de leur imposer un partenaire diamétralement opposé.
*Les paysans du Moyen-âge ont une dentition parfaite.
*Les personnages connaissent tous les numéros par cœurs, jamais besoin de consulter les pages jaunes ou un calepin avant d'appeler sa cousine au 3ème degré. µµQu'on n'a pas vue depuis qu'on avait 3 ansµµ
*Les voitures qui tombent dans le vide retombent toujours sur leurs pattes et poursuivent tranquillement leur course, avec juste un peu de tôle froissée. Si elles foncent droit sur des voitures immobilisées, elles n'ont qu'à sauter par-dessus, comme un cheval en plein jumping, avec grâce et élégance.
*Lors d'une conversation très émouvante, au lieu de parler en regardant votre interlocuteur, placez-vous derrière lui et parlez à son dos.
*Même si vous conduisez sur une avenue parfaitement droite, il est nécessaire de tourner vigoureusement le volant de droite à gauche de temps en temps.
*N'importe qui peut facilement faire décoller un avion, pourvu qu'il y ait quelqu'un dans la tour de contrôle pour lui donner l'autorisation de partir.
*On peut jouer de la plupart des instruments de musique - surtout les instruments à vent et les accordéons - sans avoir à bouger les doigts.
*Peu importent les dégâts subis par un vaisseau spatial : le système interne de gravité n'est jamais touché.
*Porter un gilet pare-balles vous rend invulnérable.
** Et oui, les méchants qui sont aussi des crétins ne pensent jamais à viser la tête ! Ils méritent bien de se faire dégommer à 40 m en mouvement par un simple tir de pistolet (ou de revolver) µµ Essayez déjà à 25 m sur cible fixe et vous m'en direz des nouvelles.µµ
*Pour se faire passer pour un Officier allemand il est inutile de savoir parler la langue. L'accent allemand suffit.
*Quand ils sont entre eux les étrangers préfèrent se parler en anglais.
**Variante : le couple_de_vieux_qui_ne_se_sépareront_pas_quoi_qu_il_arrive
*Quand votre fils (tête à claques) est atteint d'une maladie grave, le seul donneur de moelle compatible est un prisonnier criminel multirécidiviste qui ne pense qu'à s'évader. Quand cet individu va dans la bibliothèque de la prison, il a immédiatement accès aux ordinateurs et à Internet et au site du FBI. Quand le FBI s'aperçoit que l'on consulte ses LISTES top-secret, il les efface lentement une par une, pour produire un joli effet à l'écran.
*Quand vous éteignez la lumière pour vous coucher, tous les objets de votre chambre sont parfaitement visibles. Juste un peu bleuis.
*Si tu te mets à danser dans la rue, les personnes que tu prendras pour partenaire connaîtront tous les pas.
*Si une dangereuse bande de malfaiteurs est retranchée à l'intérieur d'une maison, l'intervention d'une brigade d'intervention caparaçonnée, casquée et disposant d'un armement lourd genre bazookas et de boucliers en kevlar est nécessaire pour forcer la porte. Mais le jeune inspecteur de police, héros du film, juste armée d'une arme de poing légère, vêtu d'un tee-shirt et sans gilet pare-balles sera toujours le premier à franchir le seuil.
*S'il y a un malade mental psychopathe en fuite, cela coïncide en général avec un orage qui coupe le courant et les communications téléphoniques dans les parages.
*les hommes ont 20 ans de moins que dans la vraie vie, et les femmes cinq à six de plus. Record battu par la mère de Cary Grant (55 ans pour la Mort aux Trousses, et sa mère de cinéma, Jessie Royce Landis, 63 ans)
*Un homme visé par 20 hommes a plus de chance de s'en sortir que 20 hommes visés par un seul.
* Un [zombie|ListeDeZombies] (ou un autre monstre) avançant à la vitesse d'une tortue finira toujours par rattraper la jeune fille qui elle, file le 100 mètres en 10 secondes et 4 dixièmes.
*Une fois appliqué, le rouge à lèvres ne part pas, même en faisant de la plongée sous marine.
**Faux, depuis que le politiquement correct nous a envahi (voir par exemple le Superman de Richard donner en 1978)
*Avoir un boulot comme le mien ferait que tous les pères de famille oublient le 8ème anniversaire de leur fils. -- µµ''En fait, ce qu'il faudrait dire c'est "Un père de famille se rend toujours compte à la fin du film à quel point il privilégie son boulot par rapport à ses gosses (qui sont des têtes-à-claques pour la plupart)''µµ
µµreclassé encore et toujours par alpha (%%Red(une fois de plus)%%) par la petite secrétaire du 4èmeµµ
ListeDeResultats
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** donc 3,3 hectares brûlés par mort (environ)
* renflouement de l'entreprise Alsthom - µAlstom plutôt, non ?µ %%Red(µ je crois que les 2 se disentµ)%% µµ(on s'instruit en s'amusant : Création d'Alsthom en 1928 par la fusion de la Société Alsacienne de Constructions Mécaniques, Belfort et de la Compagnie Française Thomson-Houston. 1998, introduction en bourse, renommée ALSTOM afin que le nom se prononce de façon identique dans toutes les langues)µµ
ListeDeNombresTranscendants
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* 4 = le dernier nombre premier trouvé ! (15/06/2005 vers 20 heures rue de l'ermitage dans le 20° arrondissement parisien .... )
µTranscendé par Adèle W. ('tain elle est forte Adèle !)-- zut, on a été [doublés|http://sprott.physics.wisc.edu/pickover/trans.html] -- Je la croyais morte Adèle -- Complété brillamment %%Red((hum , faudra réviser))%% par YB, stagiaireµ.
* voir aussi [ici|http://crd.lbl.gov/~dhbailey/expmath/] une magnifique image. ''et son explication '': µThis is a plot of all roots of polynomials with coefficients in (0,1,-1) up to degree N=18. These zeros are colored by their local density normalized to the range of densities; from red for low density to yellow for high density. The bands, quite clearly visible in the plot, are unexplained (C'est une parcelle de terrain de toutes les racines des polynômes avec des coefficients dans (0.1.-1) jusqu'au degré N=18. Ces zéros sont colorés par leur densité locale normalisée à la gamme des densités; du rouge pour le faible densité au jaune pour une forte densité. Les bandes, tout à fait clair évidentes dans la parcelle de terrain, sont inexpliquées)µ
Comme tu m'en as confié la mission je porte à ta connaissance les faits suivants : notre secrétaire (déléguée aux boulettes) a fait son exposé sur dzêta (3) de la façon la plus brillante. Confrontée à de fréquentes interruptions déstabilisatrices sur les nombres décimaux et autres arguties, elle s'en est magnifiquement sortie, esquivant les flèches, étouffant dans l'oeuf tout démarrage de quolibet ou de moquerie, fustigeant toute manifestation d'indifférence. Elle a donc, par là même, porté bien haut le fanion, l'étendard d'Echolalie, provoquant même quelques murmures flatteurs dans l'assistance, les mots "complètement folle" et "frappadingue" revenant le plus souvent...
Je tiens donc par le présent rapport à confirmer que notre secrétaire (déléguée aux boulettes) s'est correctement comportée.
ListeDeMotsNouveauxDeuxMilleTrois
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(__Mots nouveaux apparus en 2003 dans les dictionnaires 2004__)%%
µµCommuniqué par M. Robert et Mmme La[rousse|ListeRousse] et Officiel du Scrabble 4µµ
ListeDeCeQueJeRegretteraiToujoursDenAvoirPasFait
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* M'être cassé une jambe au lieu d'aller voir un certain film, qui par voie de conséquence a failli gâcher ma vie (comprenne qui pourra)
** ''µvous y avez découvert votre partenaire dans l'exercice de ses activités parallèles ?µ''
ListeDeSites
/* par PITIE ne mettez pas de liens vers de GROSSES.... merci
site en parabole
ListeDesVillesAyantChangeDeNom
/* par PITIE ne mettez pas de liens vers de GROSSES bourgades. merci
/* merci de compléter par ordre alphabétique, en plus ça évite les doublons :-)
* Annappes puis Villeneuve d'Ascq ben et Ascq alors ?!!! cé pas pareil ça cé des fusions de communes !
* Lutetia Parisorum, Lutèce puis Paris
* %%Red(''PARIS SERA TOUJOURS PARIS'')%% µµ...ou Ménilmontant, Ménilmuche, Pantruche, Paname, Lutèce, etc.µµ
* Pékin puis Beijing µµallez savoir pourquoi, le nom n'a changé qu'en langue française... - meuh non, l'ancienne graphie reste acceptée par chez nousµµ
* Tremblay-les-Gonesses puis Tremblay-en-France µ(le politiquement correct a encore frappé... Mouais, je crois qu'il s'agit de villes différentes, car Tremblay-en-France existe depuis des siècles, au moins depuis l'époque où la France désignait un petit territoire aujourd'hui connu sous le nom d'Ile-de-France, enfin faut vérifier... et il y a aussi le Tremblay-sur-Meauldre où Marguerite Duras venait parfois boire un petit verre entre deux romans, mais c'est une autre histoire... )µ
** µ%%Green(Renseignez-vous au lieu de dire "faut vérifier" en fait : Tremblay-sans-Culottes est devenu Tremblay-lès-Gonesse en 1886, puis Tremblay-en-France depuis le 19-8-1989 - source [le site de la ville|http://www.tremblay-en-france.fr/page/p-29/art_id-121/] (du moins pour la dernière partie), et le Quid pour le reste)%%µ
** µ%%Blue(mais non, La-Garenne-Colombes existe toujours, la Garenne-Bezons a été le nom porté par la gare Sncf jusqu'en 1985)Ca me rappelle la chanson du regretté Poulduc " Car nous voulons faire la booooooooooombe, mais toujours avec raison, nous irons jusqu'a Coloooooooooooombes et a La Garenne Baisons"µ)%%
** Plus de la moitié des exemples "qui conviennent" sont dans ce cas, c'est par évolution de prononciation que Rotomagus par exemple est devenue Rouen. Par contre Stalingrad devenant Volgograd est un changement radical de nom. Je me demande s'il ne faut pas scinder la liste... Amilcar
*Merci à celui %%Red(µ(et non, c'est celle:-))µ)%% qui, bousculant les règles étouffantes de l'orthographe, a bricolé les noms de villes qui ne collaient point avec Echo-Truque, ou pire encore. Que Dieu le lui pardonne, c'était pour le bon motif.
*Mais pourquoi s'en tenir aux villes ? Il y aussi des pays (Cipango, le Tonkin, la Burmanie...), des régions ou départements (la Creuse, les Côtes-du-Nord, les Basses-Alpes, etc.) µµla Creuse n'a jamais changé de nom, d'abord !µµ --µµC'est vrai mais elle voudrait bien !µµ--
** Imaginez une ''Liste de *** qui ont changé de nom'' !, µavec tous les gonzes cultivés qui zonent par ici... - sans causer de ceux qui savent utiliser ''Google''.µ
*** Et vazydonc pour la ListeDeDepartementsAyantChangeDeNom
*** Mézaussi ListeDesCommunesRenommeesParLaRevolutionFrancaise
%%%Liste créée par kindofblue -- %%Blue(''ah les dimanches bleus d'écholalie...!'')%%
ListeNumeroteeDeChansons
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* 1- Y'a qu'1 ch'veux sur la tête à Mathieu, y'a qu'1 dent dans la mâchoire à Jean (µMichel Polnareff - paroles de Pierre Delanoë)µ
**Traditionnel scout, plutôt, revisité par les deux précédents
* 3 - La preuve par 3 (Zazie, Saïan Supa crew, au choix)
** C'est un fameux trois-mâts (chanté par Hugues Aufray)
* 11 - Pourquoi 11 ? Parce qu'on s'fait chier
*** 86 (!) versions différentes communiquées par le Prof. Blorer (Bénanologue)
** Stalag 27 (Parabellum)
** µµLe trente février (Les Parisiennes)µµ
* 66 - Route 66 (Bobby Troup, µdevenue un standard et donc reprise par plein de mondeµ)
** Osmose 99 (Parabellum)
* 400 - Napoléon avait 400 soldats (scout, on aphérèse la phrase syllabe par syllabe)
* 300000000 — 300 Millions — Bernard Dimey (magistrale interprétation par les Frères Jacques)
*1,80 m pour 1,50 m, ça fait 3,30 m de bonheur parfait (Lucienne Delysle, je crois)
Liste commencée par El Jj
ListeDeCartes
/* par PITIE ne mettez pas de liens vers de GROSSES cartes. merci
%%Center(µµdésormais classée par alpha !µµ)%%
** Carte Didier Richard, 1/50 000 sur fond IGN, disparue tragiquement des poches du randonneur début des années 2000, revenue sous forme de pâle clone depuis.
** une autre (parce que ce n'est pas ça qui manque...) [http://idata.over-blog.com/0/40/91/64/normal_carte-gros-con.jpg]
** ou, ''"Dans la famille monoparentale, j'aurais bien voulu le père.''
* Carte du [Parti|http://www.chez.com/damienbetises/elections/carte/page.htm]
** Carte famille mono-parentale sans enfant
** "Qu'est ce que c'est une carte orange ?" (''La Redaction'') - "C'est un peu comme une carte bleue, mais elle sert seulement à prendre des ascenseurs horizontaux qu'on appelle des "métros". Pour mieux me faire comprendre d'un citoyen d'en haut, je dirais que c'est un peu comme un VIP pass qui permet de passer, par exemple de Stalingrad à Rome, d'Argentine à Iéna ou de Bir-Hakeim à Liège en moins d'une heure et sans affronter le mur du con."[http://marjorie-art.voila.net/carte_orange.jpg]
µµListe créée avec brio et succès par El Jj (''les chevilles...'') et reclassée par la petite secrétaire sexy... -- restauré après double sabotage le 5/4/08µµ
ListeDePour
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Pour l'enseignement de l'astronomie parmi les matières scientifiques de bases à l'école
* Pour le droit à la paresse (resp à la luxure, à l'avarice, à la paix, etc.)
* Pour le réchauffement de la planète (parce qu'il y aura plus de belles femmes à voir)
* Pour les caresses un peu partout
* Pour [les professeurs de français|http://www.lettres.net/parution] (Jeg encore)
* Pour un %%Red(Parti)%% des neutrinos libres et indépendants (Adele W.)
* Pour une tournée offerte par le gouvernement dans chaque bar. (Serge D.)
ListeDeContre
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Contre les 4X4 , partout et toujours (Antoine Waechter)
* Contre Vérité (Mot remis un moment à la mode par Georges Marchais quand il nous faisait rigoler à la télé)²
ListeDeLapsusRigolos
/* par PITIE ne mettez pas de liens vers de GROS LAPSUS. merci
%%Blue(''µµidée de choriµµ'')%%µµ pas très en forme ? - et reclassée beaucoup, beaucoup plus tard par la petite secrétaire sexyµµ
ListeDePonctuation
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
« L'usage laisse une certaine latitude dans l'emploi des signes de ponctuation. Tel écrivain n'use jamais du point-virgule. Une relation peut être marquée au moyen d'une virgule par celui-ci, au moyen d'un point-virgule par un autre, au moyen d'un double point par un troisième. L'abondance des virgules peut s'expliquer tantôt par des raisons purement logiques, tantôt par référence à un rythme oral qui multiplie les pauses.»
* Parenthèse ouvrante : (
* Parenthèse fermante : )
* Le symbole composé suivant : "--", n'est - jusqu'à nouvel ordre - pas considéré comme un signe de ponctuation acceptable par les honnêtes gens -- µt'es sûr ?µ
* Sourillard (ou ''smiley'') et ses diverses déclinaisons : :-) - µIl s'agit en fait de la version écrite des fameux rires enregistrés, ou des grimaces d'Eddy Murphy, destinés à indiquer au public Anglo-Saxon à quel moment c'est supposé être drôle. - %%Red(C'est pas tout à fait pareil : là on exprime un sentiment à l'instant où l'on écrit.)%% -- Mais, non ! Et que ceux qui n'aiment pas ça n'en dégoutent pas les autres, les smileys (à condition de ne pas en abuser) ne sont jamais qu'une forme amusante d'abréviation par exemple :-) je te le dis avec le sourire :-| je suis très sérieux, :-( ça m'attriste ! [Remercions au passage Echolalie de nous en offrir de si beaux !|ListeDeSmiley] %%Green(--Ouais-ouais, n'empêche !--melba)%%
** Paradis de Ph.Sollers
* Le point-virgule s'emploie pour diviser les parties d'une phrase dont une est déjà divisée par une virgule ; on évitera l'emploi excessif de ce signe ; il est de toute façon passé de mode ; %%Red((oh ! moi je ne trouve pas du tout !!! c'est un signe très utile quand on veut relier deux propositions, parfois contradictoires ; souvent découlant l'une de l'autre, ex : µ(''Il vit qu'elle s'était rapprochée ; ils se trouvaient maintenant l'un tout contre l'autre sur le divan...'' extrait de HistoireDeListes ''collectif Echolalie'')µ)%% faisant partie d'une même idée.. On termine les différents termes d'une énumération par un point-virgule. Quand une phrase a un lien étroit avec celle qui précède, elle en est séparée par un point-virgule et non par un point. ''Antoinette s’était cachée ; elle pouvait les observer ainsi très attentivement.''
** Le point-virgule peut même être érotique : "La vertu de Fabrice fut égale à son bonheur ; au matin..." (Stendhal, La Chartreuse de Parme)
* Les points de suspension peuvent avoir la même fonction que l’abréviation etc. : on emploiera donc l'abréviation ou la ponctuation, mais pas les deux. ''Notre secteur couvre la Champagne, les Ardennes_…_ ''et __non__ : ''la Champagne, les Ardennes, __etc…__'' µ(signalons le nouveau tic langagier qui fait dire "etc., etc." (deux fois, c'est important !) à tout propos, et généralement après une énumération fort courte, parfois même réduite à l'unité) -- c'est pas un nouveau "tic", c'est la langue qui évolue, ne vous en déplaise !µ
A propos de ''Eden, Eden, Eden'' : Le texte de Guyotat est un souffle où l'on a d'abord l'impression que les mots ne peuvent pas être dits et du coup pas entendus, à la limite de l'audible.%%%Pour dépasser l'inévitable sentiment de provocation et d'arrogance, induite dans la vision de cet Eden atroce, il faut accepter que chaque signe de ponctuation devienne les inspirations, les expirations, les hoquets d'un souffle qui fait éclater les formes, les marques, les taches, les contours, qui éclaboussent une toile énorme impossible à peindre, insupportable à regarder. %%% Si les mots éclatent de toute leur brillance ''("Le délire est surbrillant")'' dans leurs entrechoquements, ils le sont aussi exemplairement grâce aux signes innombrables qui les ponctuent et le texte devient véritablement intelligible et nécessaire si la rythmique se confond avec la respiration de celui qui parle. [Guyotat|http://www.theatre-contemporain.net/spectacles/eden_eden_eden/presentation.htm] bannit le point de son texte : le point arrêterait le souffle, la mort arrête la parole.
µListe créée par El Jjµ
ListeDeKennedy
/* par PITIE ne mettez pas de liens vers de GROS complots imaginaires. merci
Liste complotée par JoZgur
ListeDeBiographies
! /* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*13/11/%%Querynum(1940,1949)%% : Naissance à %%Querylist(Tarbes,Kuala-Lumpur,Paris XXème,Hazebrouck,Bratislava,Pau,Magnac-sur-Touvre,Esparros, Matignon,Juvisy,Contre-courant,Bourail,Koné,Eu)%% au %%Querynum(25,35)%% de la rue %%Querylist(de l'Ermitage,des Cascades,Georgette Bragnourd,Jean-Paul II,Jean-Pierre Paul-Jacques,Vincent Delerm,Ingmar Bergman,Woody Allen,Jean-Pierre Brisset,Jean-Philippe Botul,Adolf Hitler,Staline prolongé,Paul Touvier)%%
*%%Querynum(1950,1951)%% : Apprend à jouer %%Querylist(au golf,aux échecs,au Go,au docteur,aux billes,au gonglage,au vargling,au watchibole,aux tarots,aux quilles,à la bataille,au monopoly,à la belote,à pigeon vole,à 'je te tiens tu me tiens par la barbichette',aux osselets, à la corde à sauter, à la marelle,à trivial poursuit,à touche-pipi,à touche-caca,à mors-moi les couilles si tu l'oses,au cache-boulettes,au foot, à 'à dada sur mon bidet',du couteau)%%
*%%Querynum(1952,1953)%% : Apprend à jouer %%Querylist(au golf,à suce-crevettes,à chat-bite, à traque-minet,à la pelote slovaque,aux échecs,au Go,au docteur,aux billes,aux tarots,aux quilles,à la bataille,au monopoly,à la belote,à pigeon vole,à 'je te tiens tu me tiens par la barbichette',aux osselets, à la corde à sauter, à la marelle, au bobomalibole,à trivial poursuit,au foot,à 'à dada sur mon bidet',du couteau,à rien)%%
*%%Querynum(1955,1956)%% : Découvre dans une vieille %%Querylist(boutique,bibliothèque,poubelle,Juvaquatre,liste,armoire,marmite,arrière-salle,église,machine à tuer)%% un exemplaire défraîchi de %%Querylist(Pif le chien,Mickey,la Rubrique à Brac,la Vie mode d'emploi (plagiat par anticipation),Belle du Seigneur,la Grammaire logique,Blek le Roc,Paris-Hollywood,Glen Baxter,'randonnées avec mes scouts',le traité zen des motocyclettes,les aventures de concon,Béret rouge et soutane noire,Don Bosco)%%, et le traduit en %%Querylist(malgache,javanais,burman,braille,esperanto,bigourdan,béarnais,chtimi,moldo-valaque,serbo-croate,vitesse,plutonien)%%
** Go-Seigen ne l'a jamais battu (parce qu'il porte des lunettes)
*%%Querynum(1985,1987)%% : A la suite d'un voyage à Madagascar, défie Kasparov pour le titre de meilleur joueur d'échecs du monde
** Kasparov ne l'a jamais battu (Niet!)
** 1990-1993 : Responsable de la gestion des frais de bouche du maire %%Querylist(de Paris,d'Eu,de Guinguan,de Chinchardville,de Tananarive,de Rangoon,de Pau,de Nouméa,de Lourdes)%%
** %%Querynum(1980,1995)%% : Responsable de la section locale %%Querylist(du PC,du FN,de l'UNR,del'UDF,de l'URP,du RPF, de l'UDR,du PS,du mouvement Vert,des amis de Brice Lalonde,des amis d'Antoine Waechter, de l'association des Amis d'Ernestine Chasseboeuf,de l'Amicale des Enculeurs de Mouche,des bouffeurs de Yaourts en lutte contre les bouffeurs de yoghurt)%% de %%Querylist(la bourgade d'Esparros,Bures-sur-Yvette,Soumoulou,Lourdes,Rangoon,Paris XXème,Gana dans l'Allier,Chinchardville,Bourail)%%
** Signe la pétition pour donner le nom de %%Querylist(Jean-Philippe Botul,Georges Brougnard,Jean-Pierre Brisset, Geörgia Knap, Philibert Besson,Pustule)%% à une rue de %%Querylist(la ville d'Angers,Bures-sur-Yvette,Sauvagnon,Crosne,Paris XXème,Tananarive,Nouméa,Bourail)%%
*** ''Pour %%Querylist(un nouveau parti communiste,un nouvel ordre moral,des merguez sans graisse,l'éradication totale de la Birmanie,un sommeil sans cauchemars,des gros nénés bien fermes)%%'' (Prix %%Querylist(Sulitzer,Molvanien,Robert Hue,Danielle Gilbert,Simone Simon,Ernestine Chasseboeuf)%% %%Querynum(1990,2000)%%)
*** ''Nouveau manuel %%Querylist(d'ergonomie appliquée,du chiffonnier urbain,du démarrage des hélices d'avion à la main,du réparateur de 4X4,de l'écrivain sur clavier Azerty,du typographe dyslexique,de l'explorateur en pays à haut risque,du rammasophile contrarié,du scopophile fier de l'être)%%''
** Réalise avec quelques amis le film ''%%Querylist(mes amis et moi,moi et mes amis,moi et René et les filles,René et les filles et moi,mon 4X4 à Saint-Tropez,Wittgenstein - une vie,mon curé chez les burmans)%%'' primé par %%Querylist(la biennale de Montretout,le restaurant des Trois-Arts,le musée de l'Ermitage,l'amicale dieppoise des chinchardiers,le ministère de la guerre,le festival de Bâle,l'association des amis de Georges Brougnard,les compagnons de la chanson)%%
** %%Querynum(1960,1990)%% : Proposé pour le Prix Nobel %%Querylist(de mathématiques,de bilboquet,de littérature,d'ergonomie,d'exactitude,d'humour glacial,de galanterie,de randonnées aventureuses,d'exactitude)%% par le Républicain %%Querylist(lorrain,béarnais,tarbais,malgache,burman,de Tokyo)%%
ListeDeNomsPropresAfaireMonterlAudimatSurInternet
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Red(Cher internaute, arrivant ici par hasard, il ne t'aura pas échappé que le mot "propre" dans l'intitulé de cette liste a deux sens. Le premier associé avec le mot qui le précède, le second avec les mots qui suivent. Aussi, intéresse-toi à cette question : est-ce une syllepse de sens ou un [zeugme|ListeDeZeugmes], ou les deux %%Blue(µµ(mon capitaine ?)µµ)%%, ma foi, pourquoi pas ?)%%
* Caroline Park-Chapman
* Dian Parkinson
* Gaelle Comparat
* Natalia Paris
* Vanessa Paradise
Bigre ! "Copier/coller" de la liste cachée des mots-clef d'un site "gronibards" amerloque ? - µEt vous connaissez toutes ces personnes ''personnellement'' ?! ''Bibliquement'', peut-être ? - %%Green(Pas con, je vais coller cette liste dans mon site professionnel pour attirer le chaland... (je vends des arômes de chinchard))%% -- poésie: on trouve Vanessa Paradise iciµ
ListeDesMots
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
[http://www.bls-frenchcourses.com/parole/ParoleMar2003/mot.jpg]
* Mots d'excuse (ou mots des parents)
ListeDeVetements
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Les pardessus la jambe
** %%Red(µparce qu'il faut un qualificatif au vêtement le transformant en autre chose ; c'est ça la règle !µ)%%
* Le string léopard (à porter sous la soutane)
LettreDeMotIvaTion
! /* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Querynum(01000,99999)%% %%Querylist(BEZONS LA ROMAINE,BOURSIN-MAURICE,CROSNES,SAUVAGNON,TANANARIVE,TARBES,TRIFOUILLY LES OIES,BURNES SUR YVETTE,PARIS 16ème,ST PEGU SUR GAZON,ILE DE LESBOS,NEUILLY SUR SEINE,CHINCHARDVILLE,SARDINOCITY,BRIE CONTE ROBERT,ICI-MÊME,AILLEURS,LA-BAS,DALLAS)%%
    Je viens de prendre connaissance dans "%%Querylist(Le Canard Alterné,le Chasseur belge,l'Inhumanité,l'Observateur enchaîné,la Provence,Sud Est,Est France,Suisse Matin,le Parigot,Pif le chien,L'Humanité,25 millions d'amis,Couples-Magazine,Le Monde,La Gazette du Père Bugeaud,La bougie du Sapeur,Le Bourrier de l'Ouest,Libération,La Pravda,Bonnes soirées,Le journal d'Echolalie,Union,Le journal de Mickey,le Conard enchaîné,Sud Ouest Béarn,Spirou,l'Equipe,France Football,La Semaine de Suzette,Hara-kiri,Charlie hebdo,Swing,Hot-Vidéo,Fluide glacial,Mickey Parade,Hit-machine girl,la Vie Catholique,Santé-Magazine,la Vie du Rail,le Nouvel Obstinateur,Modes & Travelos,La vie des seins)%%" de ce jour, de votre %%Querylist(annonce,publicité,réclame,supplique,offre,arnaque potentielle,SOS émouvant,courriel,prière d'insérer,faire-part,cri dans la presse)%% pour un poste de %%Querylist(danseur mondain,testeur d'émissions de télé,valet de pied,moussaillon,joueur de triangle,sorcier,gourou,standardiste multi fonction,pilote,plombier,petit chef,teneur de chandelle,imam adjoint,simulateur d'orgasmes,gorille,boxeur,brasseur de vents,pétomane,tondeur de chiens,skipper,gestionnaire de bases de données,ouaibmestre,garçon de bain,prostitué,béotien,lecteur,technicien informatique,garagiste,veilleur de nuit,goûteur d'eau,tâteur de navets,lexicographe,boucher,guide birman,technicien en dessous de tables,étripeur de foies d'agneaux,fan de Lara Fabian,chippendale,renverseur de sauces,fantôme d'opéra,écosseur de petits pois,élément décoratif,femme-objet,homme-objet,chasseur de vélociraptors,dessinateur,voleur,détracteur,)%% %%Querylist(à mi-temps,volant,sédentaire,nocturne,matinal,vespéral,épisodique,par intérim,à durée limitée,périodique,ponctuel,remplaçant,attaché à la Direction Générale,à temps complet,spécialisé,trilingue,en 4X4,stagiaire,en alternance,monolingue,en chef,par correspondance)%%.
    Je suis %%Querylist( monolithiquement,sirupeusement,zigomatiquement,glorieusement,lâchement,bassement,honteusement,fabuleusement,prodigieusement,passablement,très,peu,vraiment,à un point que l'on ne peut imaginer,moyennement,__intensément__,plus qu',rien moins qu',passionnément,extrêmement,épouvantablement,on ne peut plus)%% intéressé par votre offre en raison particulièrement %%Querylist(des bruits de couloirs et autre rumeurs,de la haute renommée,du prestige,de l'aura,de la mauvaise réputation,de la morosité,de l'inefficacité,des salaires élevés,de la triste ambiance,du professionnalisme,de la tradition monastique,de la discipline martiale,du caractère débridé,de l'invraissemblable décontraction)%% de votre %%Querylist(e-entreprise,gargote,paquebot,grand magasin,autocar,camp d'entraînement para-militaire,bazar,secte,centre fermé,cloitre,couvent,atelier de couture,réseau multi fonction,business déshumanisé,maison de passe,banque,entreprise,usine,institution,boîte,multinationale)%% %%Querylist(au prestige inégalé,surfait, virtuel,abracadabrantesque,minable,confidentiel,hyperrréaliste,froufrouteux,fumeux,poussif,et du formalisme pesant qui y règne,réactionnaire,à la pointe du e-progrès,ultra-performant,de merde,à la réputation un peu émoussé,à problèmes,menacé d'explosion,dont on ne sait que trop qu'elle exploite les masses laborieuses)%%.
j'ai été reçu %%Querynum(1,99)%%7ème à %%Querylist(la chorale des petits chanteurs à la croix de bois, l'école de musique des gardiens de la paix sous la direction de Désiré Dondaine,Saint-Cyr,Polytechnique,la manufacture des Gobelins,l'abnégation de lettres classiques,la suite des précédents,l'école des Chartes,la classe terminale du couvent des Oiseaux,l'école des kiki du club-med,l'école Nationale Supérieure de la Magistrature et des Arts Appliqués,l'école de la rue d'U.L.M.,l'école de Police de Roubaix,l'IUFM de Niort,la promotion des cadets de St Nicolas du Chardonnet,l'Ecole Nationale d'Administration Malgache,l'Institution nationale de lofteurs à plein temps)%%. J'ai %%Querylist(raté de peu l'entrée à Normale Sup,engendré une descendance prolifique,chanté sur scène avec Régis Debré,rencontré le Pape Pie XII à Sète,connu Madame votre mère,régenté la famille royale de Suède,épousé Miss France 1984,été anobli par la Reine d'Angleterre,voyagé pendant 15 ans en Afrique équatoriale,trouvé un trèfle à quatre feuilles,réussi à toucher mon oreille avec mon petit orteil,posé des bombes au Liban,coopté Benoît XIV,raconté partout que vous en aviez gros sur la patate,crapahuté dans les Ardennes,joué de la trompette avec Boris Vian,été Préposé aux chevaux-vapeur de l'École Anormale Inférieure où je fus abrégé de philo,été vacciné contre le BCG,un voile islamique,eu la rubéole,accompli mes obligations militaires,purgé ma peine de prison,lu tout Proust,épousé une nymphomane,toute la collection de la vie du rail,un cousin qui connait un Autrichien dont la soeur petite couturière a connu Madame Robert,trouvé une fois 3 numéros au loto,composé un opéra bouffe sur la bataille de Waterloo,traduit Pétrarque en turc à Dunkerque,écrit une thèse sur l'homosexualité chez les cafards au 14ème siècle,écrit un article sur le web sur la différence entre le face-sitting et le face-farting,joué le rôle du hallebardier dans le Cid à l'Alcazar de Rodez en 1976)%% et je possède %%Querylist(un autographe de l'homme au masque de fer, plusieurs fers à repasser, plusieurs bock à lavements,le cheval de Barbie,une petite trompette et un tambour,le permis B,une jambe de bois style Louis XVI,des portes-jarretelles,une collection de porte-clés,une collection de conifères d'escargots de parapluies et de papyrus hindoustanis,toutes les vidéos de Russ Meyer,le t-shirt du dernier spectacle de Johnny Hallyday,un livre à colorier avec des vélociraptors,un collier de chien avec des clous et quelques piercings, des magasins d'objets noirs et de choses carrées)%%. A l'âge de %%Querynum(1,120)%% ans %%Querylist(et demi,et quelques semaines, et quelques jours,et des poussières,passé,et quart,trois quarts)%% j'ai créé [LA LISTE|http://240plan.ovh.net/~echolali/wiki/index.php?ListeAleatoire] sur Echolalie. Je suis %%Querylist(un peu gigolo,moustachu,équipé d'un appareil dentaire,monotesticulaire,ventripotent,sans aucune moralité,loyal,menteur,rapporteur,travailleur,blasé,nyctalope,daltonien, incontinent,insatisfait chronique,psycho rigide,priapique,chatouilleux des doigts de pieds,bien habillé,chauve ou presque,barbichu,mythomane,supporter du PSG,circonspect,psycholitique,kleptomane,fou d'Ornella Muti,pas plus mal qu'un autre,beau,replet,alcoolique,cyclothimique,frigorifiable,sexy,boulimique,fumiste,fainéant,volage,encore vierge,amorphe,super endetté,de nature studieuse,opiniâtre et méticuleuse,pilote de dirigeables sur la ligne Abidjan-Sydney,boit-sans-soif,l'affreux Jojo,un homme de bien,sujet aux rhumes en été)%%, animé d'un désir profond %%Querylist(d'aider,d'emberlificoter,d'entuber,d'arnaquer,de démolir,de calomnier,d'enfoncer,de trahir,de dire du mal de,de colporter des ragots sur,de démolir la réputation de)%% %%Querylist(mon prochain, mes voisins de palier,ma hiérarchie,mes collégues,Céline Dion, ma femme et mes gosses,ma belle-famille,mon propriétaire,les commerçants du coin)%%.
    Par ailleurs, je tiens à préciser que %%Querylist(je connais très bien,je suis un inconditionnel de,je suis comme le loup de Tex Avery quand je pense à,j'ai participé à des séances sado-maso avec,j'ai couché avec,je suis un fan de,je suis le bras droit de,je suis le larbin de,je peux réciter l'oeuvre complète traduite en Uhas de,je lèche les pieds de)%% %%Querylist(Georges Brougnard,Alain Rey,[Al Khawarizmi|http://membres.lycos.fr/alkashi/alkhawarismi1.htm],Ornella Muti,Dalida,mon guide birman,Mademoiselle Adèle,Antoinette de Gabolde d'[Audan|http://www.echolalie.com/feuille.htm],Chevalier et Laspalles,Dany Brillant,Tif & Tondu,Ludwig Wittgenstein,Plastic Bertrand)%%.
    %%Querylist(Bien que n'ayant pas,Tout en ayant)%% %%Querylist(effectué la carrière promise,persévéré,continué,pratiqué,fait des miracles,lamentablement échoué,réussi,été exploité,ramé comme un malade,brillé comme un cirage,galéré comme un damné)%% dans cette branche, j'ai acquis une solide expérience professionnelle, puisque j'ai exercé pendant %%Querynum(1,99)%% %%Querylist(secondes,minutes,jours,semaines,mois,ans,lustres,siècles,trimestres,cycles,saisons,lunes)%% %%Querylist(et demi,et quelques semaines, et quelques jours,et des poussières,passé,et quart,trois quarts)%% comme %%Querylist(sorcier,sourcier,fusiller-marin,prédicateur,testeur de fragrances,danseur de oula-oup,carabinier,testeur d'aliments pour chiens,espion,gigolo-golo,laveur de vitres ascensionnel,homme de ménage,dessinateur de valets de pique dans un atelier de fabrication de jeux de cartes,joueur de viole de gambe dans un groupe de rap,conducteur de navette spatiale,vérificateur de la masculinité du pape,contorsioniste,testeur de saucisses séches,conseiller en communication,choriste dans le film du même nom,acteur X,instituteur,ouaibemastère,funambule,cuisinier,dompteur de chinchards,chef de département,contrôleur ferroviaire,homme de paille,ministre,coursier,boulanger,grand reporter,fonctionnaire,DRH,pharmacien,péripatéticien,épistolier,funambule,prête-nom,homme à tout faire,cornac)%% %%Querylist(dans les chasseurs à pied,à la banque Lazard,dans un cirque,dans une école maternelle,chez Enron,dans un cabinet d'avocats,dans un amphithéâtre,au zoo de Vincennes,dans une maison de disques,dans une clinique psychiatrique,au journal 'Le Matin de St-Ouen',sur un chalutier chinchardier,dans une maison close,dans une entreprise de cartes à puce,à la préfecture,chez Jules de chez Smith en face,chez Arthur Andersen,chez Altedia,chez Borniol,à la NASA,aux archives du KGB,dans les vignes du seigneur,chez Citron,à la prison des Baumettes,chez Ptit Louis,aux Twin Towers,à l'usine AZT,à la Tour de la Défense,à la DDE,à l'Assemblée nationale,à l'ambassade de Burmanie,dans une SSII,sur une plate-forme pétrolière,dans un cabinet de dentiste,au centre hospitalier,au Père Lachaise,au 5ème régiment de parachutistes de Pau,à la Gendarmerie nationale)%%, où j'ai donné toute satisfaction à mes %%Querylist(coéquipiers,admirateurs,voisins de cantine,voisins de galères,tortionnaires,supérieurs,gardiens,anges tutélaires,petits poissons rouges,concurrents,co-disciples,complices,camarades d'atelier,exploiteurs,potes,copines,compagnons de beuverie,maîtresses,clientes,malades,patientes,administrés,voisins de palier,maîtres de stage,coreligionnaires,épouses,détracteurs,garants,parents,soeurs,frères,enfants,surveillants)%%.
    Mon %%Queryword(nom+fem,i*ité)%% et mon sens du %%Queryword(nom+mas,*isme)%%, alliés à une extrême appétence pour %%Querylist(les fonctions directoriales,le travail bien fait,les bains turcs pris en équipe,les choses nouvelles,les contacts humains,les tapes dans le dos, les chatouilles ciblées,les subalternes proactifs,les stocks-options judicieusement et généreusement distribuées,les relations franches et directes,les partouzes de bureau,les commérages de service autour d'un pot,les contrats gagnant-gagnant, les ragots de machine à café,la langue de vipère,les bOOnnes actrices,les subalternes fayots,les commérages,les médisances,les missions spéciales,les embrouilles d'entreprises,le harcellement sexuel,le léchage de cul,amours ancillaires)%%, me permettront de m'intégrer rapidement au sein de votre %%Querylist(société,bouzin,club,organisme,équipe de direction,équipage,ordre,troupe,machine à exploiter,famille,groupuscule,confrérie,pôle cynégétique,boîte bordélique,pool de dactylos,équipe de ripoux,bande de poufiasses,congrégation)%%.
%%Blue(µµidée de sol inspirée par le calvaire d'Ed.%%%Grand Inspirateur : [Nino Ferrer|http://www.geocities.com/foursov/ferrer/] (tu nous manques...)%%%Conseiller aux formules : Jerphanion%%%Conseiller technique dévoué et infatigable : Echobot %%% Assistants techniques : __%%Querylist(Marcel,Louis,Pierre,Paul,Jacques,Jean,Maurice,Roger,René,Lucien,Robert,Raymond,Daniel,Gérard,Gilbert,Henri,Michel,Benoît,Herman,Christian,Charles,Edouard,Richard)%%-%%Querylist(Paul,Marcel,Louis,Jacques,Jean,Maurice,Roger,René,Lucien,Robert,Raymond,Daniel,Gérard,Gilbert,Henri,Michel,Benoît,Herman,Christian,Charles,Edouard,Richard,Pierre,Marie,Esprit,Claude,Denys)%% %%Querylist(Petit,Klein,Ker,Gros,Bon,Ba,Be,Bi,Bo,Bu,Da,De,Di,Do,Du,Pa,Pe,Pi,Po,Pu,Shlock,Van)%%%%Querylist(nou,roi,con,voin,glou,pan,son,la,fran,stau,fleu,)%%%%Querylist(bier,pier,von,rin,cher,chez,coli,boule,sky,vitch,dec,long,daine,nstein,adou,rberg,ensen,enko,poulos,sis,)%%__ et __%%Querylist(Raymonde,Carmen,Denise,Monique,Michelle,Martine,Simone,Anne-Marie,Jocelyne,Yvette,Margueritte,Odette,Odile,Pauline,Paulette,Veronique,Gisèle,Augustine,Juliette,Mauricette,Fernande,Antoinette,Tristane)%% %%Querylist(Gra,Sal,Fa,Fe,Fi,Fo,Fol,Fu,Gron,La,Le,Li,Lo,Lu,Ma,Me,Mi,Mo,Mu,Kraul,Glock)%%%%Querylist(guin,guier,gron,lier,man,checo,tos,ski,vitz,storm,nberg,lac,rac,pont,doux,m'ba,enson,rian,bach,zac,bus)%%__µµ.)%%
ListeDeDeclarations
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeNomsCommunsAtouslesSitesquifontdelAudimatSurInternet
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Red(Cher internaute, arrivant ici par hasard, il ne t'aura pas échappé que le mot "commun" dans l'intitulé de cette liste a deux sens. Le premier associé avec le mot qui le précède, le second avec les mots qui suivent. Aussi, intéresse-toi à cette question : est-ce une syllepse de sens ou un zeugme, ou les deux, ma foi, pourquoi pas ?)%%
ListeDesEnnemisPublicsNumeroUn
/* par PITIE ne mettez pas de liens vers de GROS ennemis public n°1. merci
ListeDeTournois
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*µµ-- Permettez moi de me révolter contre l'usage du puits dans ce noble art du pierre, feuille, ciseaux. En effet le puits ne respecte pas l'équilibre triangulaire du jeu en se faisant "battre" par 1 élément et en en battant 2, je vous laisse méditer la dessus.--µµ
** µµje co-signe la dénonciation de cet ajout tardif %%Red((non pas tardif, il y était depuis le début))%%, injustifié, disgracieux, dont l'intrusion intempestive dans un système parfait devrait choquer tout un chacun, et qui de toutes façons ne résiste ni à l'approche poétique, ni à l'approche mathématique, ni à l'approche chorégraphique, ni à aucune autre !µµ
µ - Arghhhh ! Plein de "papier !" ce coup là. Queryword est atteint par le syndrome de Sarkozy ?µ
ListedOrdreDuJourTrois
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* %%Red(__versement des cotisations 2004__)%% (rappel : 15 euros pour les personnes imposables et 5 euros pour les autres) - Quoique...ne serait-il pas plus normal que les personnes non imposables - qui ne payent donc pas d'impôts, s'acquittent de cotisations plus élevées que les personnes imposables qui elle en payent ? Cela me paraît relever de l'égalitarisme le plus basique.
* Parrainage de Clément ?
** Remise en question de l'abandon de l'ancien nouveau forum. A l'usage, il présente des tas d'avantages. N'y a t il pas eu un défaut d'information préalable de la noble assemblée de la part de notre Ouaibmaistre (adoré, nez en moins...) %%Smiley(love6)%% %%Blue(''(demander conseil à J.P.R.)'')%%
** Lors de la création de l'association Echolalie, deux des membres fondateurs faisaient DÉJÀ partie de l'association Les amis de JB Botul; ils soutiennent naturellement ce projet.
** Savez-vous que J-B Botul sera représenté par un éminent invité d'honneur ? :-)
* %%Red(__point sur le prix Georges Brougnard__)%% : compte à rebours (trouver un espace pour le travail préparatoire ==> l'ancien forum ?)==> Pour action immédiate==> espace association/[PrixGB|http://www.echolalie.org/forum/viewtopic.php?t=20]
** Voir ListePreparatoirePourLePrixGeorgesBrougnard
* ce point parait fallacieux, puisque le wiki est ouvert AU MONDE ENTIER, et non aux seuls membres de l'assoc. Le Pdt n'a pas l'intention d'ester en justice contre le MONDE NETIER ([ENTIER|ListeDeLapsusRigolos ]).
ListeDeMotsNexistantPasSurEcholaliste
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Et comme ils y figurent à présent, il convient de les enlever de la liste, à la suite de quoi il faudra les y remettre, et ça risque d'être un boulot à plein temps. Je propose donc d'inscrire __MG__ dans la __liste des initiales de personnes ayant inventé le mouvement perpétuel__.'' µµ -- disons une seule occurence, ou uniquement dans cette page, et on n'en parle plus -- Ah oui mais le titre de la liste n'est plus bon, à ce moment là. ''Liste des mots n'existant pas sur echolaliste sauf et eventuellement dans cette liste'', devrait-on l'appelerµµ
µµ(On pourrait appeler ça couper les cheveux en quatre, et dans le sens de la longueur, par dessus le marché, vu que si un pékin, conscient de ce qu'il fait, ou totalement inconscient de la gravité de ses actes, intervient dans n'importe quelle liste pour glisser un mot figurant ici-même, il bouzille l'important travail de vérification, de recherche, de compilation et d'expertise du créateur de cette liste-ci ...)µµ
ListeDePiecesDansUneMaison
/*par PITIE ne mettez pas de liens vers de GROSSES images. merci####
%%Center(%%Blue('' Il y a des appartements où les meubles poussent mal. Eugène Ionesco'')%%)%%
* Oratoire (proposé par nous....)
* Salle se pareille
* Sortie ''(vous n'allez tout de même pas sortir par l'entrée ?)''
* Suite parentale
J'ai plusieurs fois essayé de penser à un appartement dans lequel il y aurait une %%Blue(pièce inutile)%%, absolument et délibérément inutile. Ça n'aurait pas été un débarras, ça n'aurait pas été une chambre supplémentaire, ni un couloir, ni un cagibi, ou un recoin. Ç'aurait été un espace sans fonction. Ça n'aurait servi à rien, ça n'aurait renvoyé à rien. %%%Espèces d'espaces ''Georges Perec''
Liste créée par El Jj
ListeDesChiffres
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center((à illustrer par un extrait de comptine, merci...))%%
* 4 [http://img.incine.fr/affiches_film/big/Les-quatre-filles-du-docteur-march_63767_1290632555.jpg]%%Center(Il a quatre chaussettes%%%à grosses côtes je crois%%%tricotées en cachette%%%par un chat angora%%%on dirait qu'il s'en va%%%rendre visite au roi%%%un tigre en falbalas%%%as-tu jamais vu ça ?)%%
* 5 [http://images-eu.amazon.com/images/P/2211032508.08.MZZZZZZZ.jpg]%%Center(Cinq petits doigts qui s'ennuient%%%s'en vont en voyage%%%Cinq petits doigts qui s'ennuient%%%s'en vont cette nuit.%%%Le plus gros part en camion%%%Le deuxième part en avion%%%Le troisième part en auto%%%Le quatrième en vélo%%%Le petit dernier est parti à pied.)%%
* 7 Beauuucoup de choses vont par [Sept|ListeDeCeQuiVaParSept]
* Mais non c'est absolument faux, encore une légende qui a la vie tenace... Relisez donc Alexandre Dumas : pendant tout le roman, d'Artagnan n'est pas mousquetaire, mais membre de la compagnie des Essarts, et c'est seulement à la fin du livre qu'en guise de récompense il est admis parmi les Mousquetaires du roi.'' - µDonc...µ
ListeDePlusBeauxVers
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Honorés par le pas, éclairés par les yeux
** Je servis engagé par mes premiers serments.
* Paul Verlaine - ''[Gaspard Hauser|http://fr.wikipedia.org/wiki/Kaspar_Hauser] chante (Sagesse)''
* Paul Verlaine - ''[Hier, on parlait de choses et d'autres|http://www.poesie.webnet.fr/poemes/France/verlaine/51.html]''
**Or, hier je suis parti plein d'ivresse :
**Il respire, humblement tapi parmi la mousse...
**Les parfums ne font pas frissonner sa narine
**Seigneur que tant de mers me séparent de vous ?
**Que le courroux du Ciel allumé par mes voeux
*** µµJe chante les combats du héros qui fuit les rivages de Troie et qui, prédestiné, parvint le premier en Italie, aux bords de Lavinium;µµ
**Dieu, soupire à part soi la plaintive Chimène,
*** mais la vie sépare ceux qui s'aiment,
µµCommencée par Jean-Louis Baillyµµ
ListeDeNomsDeRestaurantsContenantUnJeuDeMot
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*L'__Appart des Anges__ µ(bar à vin, rue d'Emery, Nantes)µ
*Le __Bar Parallèle__
*L'__Enfance de Lard__ µ(Paris)µ
*__Legendre Idéal__ µ(rue Legendre, Paris)µ
*La __Mère agitée__ µ(rue Campagne-Première, Paris)µ
*Au __1000 Pâtes__ (rue de Charonne, Paris)
%%Image(http://misskaparis.files.wordpress.com/2009/06/1000pattes.jpg,500,342)%%
*Les __15 vins__ Rue Dante, Paris V. (bar à vins)
*__Tapas Nocturnes__ µ(rue des Martyrs, Paris)µ
[http://cdn.ou-dejeuner.com/bibliotheque/point-dejeuner/75/paris-18/380/tapas-nocturnes_96c.jpg]
*__Au Lion d'Or__ µ(Ce sont des hôtels qui portent ce nom... quoique certains font peut-être aussi restaurants. Cette appellation, assez fréquente depuis des siècles, était à l'origine dûe à la recherche d'honorabilité de la part de ces établissements. Afficher : « Ici au Lion d'Or » sur la façade d'une auberge, ou carrément : « Ici au lit, on dort », voulait dire qu'on n'y faisait pas autre chose, que le voyageur ne devait donc pas se méprendre : ici ce n'était pas un bordel, et on était prié de ne pas lutiner le personnel féminin !)µ
*__Homme et Gars__ µµ(coiffeur pour hommes -- Encore une fois, tiré par les cheveux!)µµ
ListeDeListesVides
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Liste des mots comportant un 'e' dans la Disparition de Pérec
ListeDeFootballeurDeLouis
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeEphemere
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [Il n'y a pas d'amour heureux|http://textesbrassens.ifrance.com/textesbrassens/il_n_y_a_pas_d_amour_heureux.html] (Brassens, texte d'Aragon - également chanté par Barbara, Nina Simone et d'autres)
** %%Blue(''Mais la vie sépare ceux qui s'aiment, tout doucement, sans faire de bruit, et la mer efface sur le sable les pas des amants désunis...'')%%
* La fête, éphémère, brise parfois le cours d'une histoire. ''Jean Duvignaud''
* effet mémère [http://www.tibooparc.com/histoires/images/velom02.jpg]
* [Mon amie la rose|http://www.paroles.net/texte/18522/artis/1877] (Françoise Hardy)
** On a beau avoir une santé de fer, on finit toujours par rouiller.
** Bien sûr, j'ai pensé parfois mettre fin à mes jours, mais je n'ai pas su par lequel commencer.
* Ecrire : essayer méticuleusement de retenir quelque chose : arracher quelques bribes précises au vide qui se creuse, laisser, quelque part, un sillon, une trace, une marque ou quelques signes. ''Georges Perec''
* ListeDeTotologieParNonoOuBrevesDeComptoir
* Les sons doivent être saisis au vol par les ailes pour qu'ils ne tombent pas dans les oreilles des sourds. ''Eugène Ionesco''
* ListeDeDisparus
* Les choses que nous avons passent, et par leur nature éphémère même elles sont sans valeur. ''Henry Miller''
%%Blue(''µµidée de sol inspirée par une remarque d'Adèleµµ'')%%
ListePerenne
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* ListeDePlaquesCommemorativesParisiennes
ListedeChosesDifficiles
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Absorber par la voie orale l'intégralité d'un paquet de biscuits Lu™ en moins de cinq minutes - µc'est impossibleµ [http://chateau.goulaine.online.fr/images/lulu.jpg]
* Apprendre le Mahabarata par cœur
* Avoir des dons particuliers pour accueillir la lumière de l’Esprit
** µDes japonais l'on fait, en fait les premières décimales, pour un ordinateur particulier, car il y a plusieurs nombres de Chaitin.µ
** µCertes, il convient de préciser la machine programmable envisagée (par exemple celle dite de Turing ''officielle''); néanmoins, quel que soit ce choix, on ne pourra en connaître qu'un nombre fini de décimales, d'où la présence de cet item dans la liste... [cf.|http://www.cs.auckland.ac.nz/CDMTCS/chaitin/delahaye.html]µ
* Danser un tango au Balajo (rue de Lappe) avec un archiprêtre en string léopard
* Décrire Dolly Parton sans les mains [http://www.cdshakedown.com/01_2003/dolly_photo5.jpg]
*** µPour la sphère, ça ne me paraît pas trop dur : supposons une carte sphérique non coloriable avec 4 couleurs, envoyons un point intérieur à l'une des zones à l'infini pour obtenir un plan, la carte projetée sur le plan n'est pas coloriable avec 4 couleurs, par conséquent... (où est l'erreur ?)µ
*** µ%%Green(L'erreur est de le démontrer pour un plan (qui n'est qu'un cas particulier de sphère))%%µ
* Enlever sa culotte __sans__ enlever son pantalon µdifficile, mais pas impossible: fait par Rowan Atkinson dans un court-métrage de Mr Bean !"µ
* Enlever son pantalon par la tête.
* Etablir le mystère de la Sainte-Trinité grâce à la preuve par neuf µpar neuf, non, il y a plus simple que çaµ
* Faire transiter au moins 10.000 litres de Ricard™ en au plus 50 ans par votre tube digestif - pas facile, mais jouable.
* Imaginer G.Dabeuliou Bush et Harl Rove s'adonnant à un concours de pets dans le bureau ovale de la Maison blanche (il paraît que cela est advenu)
* Jouer la seconde partie de ''Jeux interdits'' sans se tromper
* Mettre Kasparov ''[fanny|ListeDeFanny]'' à la belote de comptoir
* Mourir d'un infarctus pendant la béatification d'un pape µ(difficile mais réalisé par un cardinal espagnol le 1er mai 2011)µ
* Supporter les imbécillités "politiques" de certains participants qui sont persuadés d'avoir tout compris, seuls contre tous
* Toucher son nez avec sa langue (à part les caméléons mais bon)
* Traverser Paris en apnée
* Traverser Paris en respirant
* Faire fonctionner un pécé sous Windows™ sans planter plus d'une fois par jour
µListe proposée et initialisée, non sans difficultés, par S. (attention, pas Sol !)µ
ListeDeChoux
/* par PITIE ne mettez pas de liens vers de GROS CHOUX images. merci mon choux
**µµfermez vos parenthèses, les courants d'air, bordel !µµ
* [Je suis l'homme à tête de chou|http://www.paroles.net/chansons/15705.htm]/moitié légume moitié mec/pour les beaux yeux de Marilou/je suis allé porter au clou/ma remington et puis mon break...Ma feuille de chou/ à scandale qui m'donnait le bifteck... [http://monsu.desiderio.free.fr/jardin/tetedechou.jpg]
Liste créée par Kindofchou (ha ha) -- haha sacrée Kindofchou , on te reconnaît bien là. ... c'est vrai qu'il est chou !... :-) et agrégée par [le Comité de défense des légumes|ListeDuComiteDeDefenseDesLegumes]
ListedeListesdePersonnagesExtraordinaires
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeBrune
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [Le Parc de Pierre-Brune à Mervent en Vendée |http://www.mervent-foret.com]
µµListe créée par El Jjµµ
ListeDeVerbesSourcesDePlusieursSubstantifs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** 3 p'tits tours et puis s'en vont (si vous voulez des tours supplémentaires, c'est par [ici /ListeDeTours])
ListeDeDefaites
/* par PITIE ne mettez pas de liens vers de GROSSES déroutes. merci
* Vercingétorix battu par Jules César à __Alesia__ (50 avant JC)
* __Roncevaux__, défaite de l’arrière-garde de Charlemagne, surprise par les Vascons le 15 août 778 au retour d’une expédition en Espagne
* Le 26 août 1346, l'armée française est taillée en pièces à __Crécy__-en-Ponthieu, entre Amiens et l'embouchure de la Somme par l'armée anglaise commandé par le roi Edouard III et son fils, le Prince Noir (qui n'avait que 16 ans à l'époque !)
* Le 19 septembre 1356, l'armée française est écrasée par les archers anglais au nord de __Poitiers__. Le roi Jean II le Bon est lui-même fait prisonnier [http://medieval.mrugala.net/Jean%20II/Bataille%20de%20Poitiers.jpg]
* Le 25 octobre 1415, la «fleur de la chevalerie française» est anéantie à __Azincourt__, au nord de la Somme, par les archers et les piétons du roi d'Angleterre. Les pertes sont énormes du côté français (près de 10.000 hommes contre 1.600 du côté anglais). La plupart des prisonniers (1.700 environ) sont égorgés par les archers sur ordre du roi Henri V. Ce bilan fait d'Azincourt l'une des batailles les plus meurtrières du Moyen Âge occidental.
* __Trafalgar__ : 21 octobre 1805, la flotte de Napoléon 1er est battue au large du cap Trafalgar, non loin de Cadix par la flotte anglaise commandé par l'amiral Horatio Nelson (qui y périra)
* __[Waterloo|ListeDesOfficiersFrancaisTuesaWaterloo]__ : L'épopée napoléonienne s'achève le 18 juin 1815 à Waterloo, à quelques kilomètres au sud de Bruxelles. L'empereur des Français réunit en toute hâte une armée de plus de 100.000 vétérans. Il décide d'attaquer en Belgique les Anglais et les Prussiens, avant qu'ils ne soient rejoints par les Autrichiens et les Russes.
L'Empereur bat les Prussiens du général Blücher à Ligny, entre Charleroi et Namur. Il ordonne à Grouchy de les poursuivre avec son armée. Le surlendemain, lui-même attaque les Anglais du général Wellington, solidement retranchés sur le plateau de Mont-Saint-Jean, près de Waterloo. Comme le sol est détrempé par un violent orage survenu la veille, l'artillerie se déplace mal et Napoléon n'arrive pas à rompre les défenses anglaises. À la fin de la journée, Blücher débouche de façon inattendue sur le flanc de l'armée française et entraîne sa débandade. Protégé par les grenadiers de la Garde impériale, que commande Cambronne, Napoléon quitte prestement le champ de bataille et retourne à Paris. Il comprend alors que tout est fini. Vient l'exil définitif à Sainte-Hélène.
* Le 2 septembre 1870, les Prussiens reçoivent la capitulation d'une armée française enfermée à __Sedan__, dans les Ardennes. Ils font 83.000 prisonniers y compris l'empereur des Français. Napoléon III envoie un simple télégramme à l'impératrice Eugénie : «L'armée est vaincue et captive, moi-même suis prisonnier». C'est la quatrième fois dans l'Histoire de France qu'un souverain est capturé sur un champ de bataille. Ce désastre signe l'échec de la guerre engagée à la légère par les Français six semaines plus tôt.[http://marjorie-art.voila.net/Biog/Napoleon_III_3.jpg]
** __Napoléon Bonaparte__ !
*En général, défaite des uns = victoire des autres. Tout dépend du point de vue de celui qui parle/écrit. Exemples : Waterloo et Austerlitz qui ont leurs gares respectives dans les pays qui les considèrent comme des victoires (µNDR : Je ne suis pas sur que ma phrase soit correcte mais j'espère que je me suis fait comprendreµ) -- Les perfides anglais faisait descendre les français du TGV à Waterloo Station, les français font arriver les anglais à la Gare du Nord !
*Et en général, ce sont les vainqueurs qui écrivent l'histoire, l'arrangeant parfois à leur guise en fonction de leur propre intérêt.
ListeDeMotsCourantsQuiNaboutissentAaucunesReponsesDansFindPage
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Parapente (ListedesTrucsFabriquesPourseProtegerDunPeuTout)(ListeQuestionnaireDeKedlagueul
* [primipare|ListeDeMotsQuonComprendPasMaisQuOnAimeBien ]
* Je dirais un mot que l'on peut employer dans une conversation de tous les jours sans passer pour quelqu'un appartenant aux cercles des poètes dans le désarroi.%%%
µListe institutionnalisée par El Jjµ
ListeAleatoire
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeNoels
/*Par pitié ne poussez pas le père Noël dans la cheminée ! Merci
*Les cadeaux et idées de cadeaux, comme il y en a beaucoup, font l'objet d'une [liste spéciale et séparée|ListeDeCadeauxDeNoel] [http://pagesperso-orange.fr/lemomo2/Xmasmail2.gif]
* Les parents du Père Noël auraient aussi souhaité que leur fils existe vraiment. ''Jean-Michel Serveaux''
* Et les rennes on n'en parle plus ? [http://pagesperso-orange.fr/lemomo2/Xmassurf.gif]
* Bénédiction urbi et orbi par le Prelat Preli
* C'est l'histoire d'une femme parfaite et d'un homme parfait. Un jour ils finissent par se rencontrer. Et bien sûr, ils se marient, achètent une voiture et partent en voyage de noce. En route ils rencontrent le Père Noël qui fait du stop. Ils le prennent en voiture avec eux. Malheureusement, ils ont un accident. Un seul de ces personnage a survécu, lequel ?
ListeDesAnes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* A bove ante, ab asino retro, a stulto undique caveto ! (''Prends garde au bœuf par devant, à l'âne par derrière, à l'imbécile par tous les côtés !'')
* Âne allemand parlant bla bla
* L'Âne Culotte (par Henri Bosco)
* N'importe quel homme a le droit de comparer une femme à une jument, à condition qu'il sache qu'il n'est lui même qu'un âne.
* ''Une fête fort populaire au Moyen Age était la __fête de l'âne__ : La veille de Noël, une jeune femme portant un enfant dans les bras rentrait dans l'église à dos d'âne en pleine messe. Toutes les prières se terminaient alors par "hi-han". On comprend que l'Eglise ait rapidement mis cette coutume hors de sa loi !''
µµListe créée (laborieusement) par Kindofblue -- J'avais oublié qu'on ne peut pas mettre 2 majuscules de suite dans le titre...µµ
ListeDeChevaux
/* par PITIE ne mettez pas de liens vers de GROS dadas. merci
!Canassonymes particuliers
* [Bucéphale | http://www.paroles.net/chansons/24912.htm], le cheval d'Alexandre
**adapté du folklore russe en 1973 par [Marina Vlady|http://www.bide-et-musique.com/song/6466.html]
* [Saucisson |http://www.paroles.net/chansons/21613.htm], et encore [un autre| http://www.paroles.net/chansons/21614.htm] en prime
* Fernandel µ(en dépit des apparences)µ
µµListe créée par Kindofblue (décidément dans un trip animalier... (zoo ?) après les ânes voilà les chevaux... hue !!)µµ
ListedeLettresAmphigouriques
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Reconnaissant de l'appui de votre accueil indispensable à mes domiciliations informatiques, assurées personnellement, l'obtention des soins ne peut être un risque médical, chirurgical, pharmaceutique, explicite pratiquement par courrier intervenu de Sécurité Sociale renouvelable (carte vitale).
%%Center(Amphi = abréviation d'Amphithéâtre, entre parenthèse ils ont l'air passionnés les mecs...)%%
** une liste peut etre vide. Par définition une liste est soit une liste vide, soit une liste suivie d'un élément. (Fabius Cunctator)
ListeDePersonnagesDansTintin
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** ''Pardon... Un peu plus à l'ouest ''
Liste créée par El Jj
ListeDeScandalesLitteraires
! /* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* On a retrouvé un 'e' dans 'La Disparition' de Georges Perec. Editions Gallimard L'Imaginaire - 3 avril 2003 - page 119
Communiqué par
Et pourquoi a-t-il choisi un poème pour implanter son e ? Parce que les
Et pourquoi un seul e ? Est-ce parce qu'ainsi il y a le moins de chances
quelque part dans la version imprimée de la Disparition." (p. 424)
nuit par leurs étudiant(e)s le texte de La disparition pour ensuite pouvoir
pour leur propre compte et sans effort, et ils ont attendu pareillement
l'apparition d'un petit e encadré, mais en vain.
camarade toujours présent parmi eux ? < Ne poussez pas. < Faudra-il lancer
%%Center(DERNIERES NOUVELLES DE LA DISPARITION)%%
%%Red("Alors que l'on vient à peine de signaler, sur la Liste Perec, un second "e" dans la Disparition, version Gallimard d'avril 2003, page 53, je viens à mon tour de tomber sur le 3ème. Il se trouve page 235 : "...allume son chibouk...".)%%
Dans l'article Parité, l'auteur s'étonne que certaines professions soient
La Vie, mode d'emplette. Il a aggravé son cas par un exercice de style
particulièrement brillant, La Disparition, en réussissant l'exploit d'écrire
__Ceci devrait mettre fin à la polémique sur la cause des apparitions de 4 e__
'' Le numéro 4 des Subsidia annonce la tenu d&#8217;un colloque Oulipo chez François Le Lionnais, un exposé de Jacques Roubaud, nouvellement élu, sur le jeu de go et l&#8217;élection de Georges Perec. Dès le numéro 5 le fameux "lipogramme en e", La disparition, est annoncé. Un extrait en est publié dans le numéro 6, notamment Booz assoupi. Perec est désormais "auditeur emphythéote" du Collège''
Peut être bêtement, du à la tendance général de faire saisir les textes par des Pakistanais payés un bol de riz ?
** "Cela commence par des remarques anodines, mais bientôt il faut se rendre à l'évidence: il y a plein de "E" dans "la Disparition". On en voit d'abord un, puis deux, puis vingt, puis mille ! Je n'en crois pas mes yeux. J'en parle avec Claude. On peut penser que je rêve On regarde à nouveau: plus de "E". Tout de même! Mais de nouveau, si, en voilà un, un autre, et encore deux autres, et de nouveau, plein! Comment se fait-il que personne ne s'en soit jamais aperçu?"
ListeDeDictionnairesPlusOuMoinsUtiles
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** [Dictionnaire de particuliers en général peu célèbres|http://www.pagesjaunes.fr/pb.cgi?]
** [Poèmes encore|http://lapoesiequejaime.net] (choisis par une québécoise)
** [Chansons|http://www.paroles.net/]
*** [Version non expurgée|http://paroles-de-chansons.abazada.com/]
** [Wikipédia|http://fr.wikipedia.org/], encyclopédie mise à jour par les utilisateurs.
** Le logiciel a donc décidé d'activer son correcteur d'erreurs pour rechercher chinchard et les mots apparentés dans tout le texte du TLF.
** Chinchard n'a été trouvé nulle part dans le TLF.
** Aucun mot apparenté n'a été trouvé.
Liste proposée par Gilles (MERCI à lui)
ListeFolle
/* par PITIE ne nous empêchez pas de mettre de GROSSES images. merci
* Fou, Foo Fighters, Mad Lighters (3 bons groupes de zik parmi d'autres)
* paranoïa
µµListe créée par El Jjµµ
ListedeProposSexistesRevoltants
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* __[Benoît de Macadamia|ListeDeCitationsExtraitesDesOeuvresDeBenoitDeMacadamia]__ : Le baisemain permet à l'homme de fantasmer sur le doigt que la dame vous rentrera dans le cul. ''En passant par la Loren, Cahiers du cinéma, 1988''
* __Henry Youngman__ : Les gens me demandent le secret de notre long mariage : Nous prenons le temps d'aller au restaurant deux fois par semaine, dîner aux chandelles, musique douce, quelques pas de danse... Elle y va le mardi, moi le jeudi.
* __Jacques Chirac__ : Pour moi, la femme idéale, c'est la femme corrézienne, celle de l'ancien temps, dure à la peine, qui sert les hommes à table, ne s'assied jamais avec eux et ne parle pas.
* __Jules Renard__ : L'homme est un roseau pensant, la femme est un roseau dépensant. ''paraphrase d'une pensée de Pascal''
* Il y a deux ans que je n'ai pas parlé à ma femme, c'était pour ne pas l'interrompre.
* __Lewis Smithson__ : Je connais une femme aux mensurations quasi parfaites :90-60-90. Idem pour la jambe gauche...
** La femme idéale ? C'est celle qui est partie.
* __Pierre Auguste Renoir__ : Les femmes mettent parfois beaucoup de temps à s'habiller parce qu’elles doivent ralentir dans les courbes.
* __[Pierre Desproges|ListeDesproges]__ : La femme est assez proche de l'homme, comme l'épagneul breton. A ce détail près qu'il ne manque à l'épagneul breton que la parole alors qu'il ne manque à la femme que de se taire. - ''Dictionnaire du superflu''
* Quand on me parle d'une femme cultivée, je l'imagine avec des carottes dans les oreilles et du cerfeuil entre les doigts de pied.
*Cagole : Fille de mauvais genre, d'allure vulgaire. "Regarde un peu cette cagole avec ses bottes à franges." (parler marseillais)
*Chichourlette (terme affectueux en parler marseillais)
*Filoute (femme d'apparence coquine)
*Wagon : Femme usée par la débauche.
* Associé avec une femme, le démon lui-même perd la partie
* Un [baiser|ListeDeBaisers], pour un mec c'est un moyen de faire arrêter de parler une nana qui dit des paroles superflues
* C'est l'histoire d'une femme parfaite et d'un homme parfait. Un jour ils finissent par se rencontrer. Et bien sûr, ils se marient, achètent une voiture et partent en voyage de noce. En route ils rencontrent le Père Noël qui fait du stop. Ils le prennent en voiture avec eux. Malheureusement, ils ont un accident.
** Réponse : La femme parfaite, bien sûr. C'est le seul personnage réel car tout le monde sait que l'homme parfait, comme le Père Noël n'existent pas.
** Parce que le génie frise souvent la connerie.
** Parce que c'est moins lourd qu'un lave-vaisselle.
** Parce que c'est livré avec le cerveau !
** Une pour dire des conneries, l'autre pour se les faire pardonner.
** Parce qu'elles croient qu'à la fin ils vont se marier.
* Pourquoi les hommes éjaculent par saccade ?
** Parce que les femmes avalent par gorgée
** Aucune, c'est bien trop cher par rapport au temps que l'on passe dedans µ, et c'est les copains qui en profitent.µ
* Quelle est la partie de la voiture la plus dangereuse ?
* "Ils ne viennent plus aux prières. Mêmes pour les prières du vendredi (le jour sacré musulman), il n’y a que trois personne", affirme l'imam, Mustapha Patin, 27 ans, installé dans le village de Kotanduzu, dans l’est du pays ou les traditions patriarcales restent particulièrement vivaces.
* [http://home.nordnet.fr/~caparisot/images/istanboul.jpg]
* µPar devant et par derrière.µ
*µµ(Elmer Food Beat / Daniela / Paroles: V. Lemoine, Elmer Food Beat / 1990)µµ
# Chaque matin, levez-vous avant lui et préparez-lui un petit déjeuner santé.
# Pour le dîner, préparez-lui un mets succulent accompagné d'un vin fin.
# Ne lui demandez pas de partager les tâches domestiques car il a probablement eu une journée difficile.
# Et le plus important... faites l'amour avec lui plusieurs fois par semaine...
Ne convient pas __Parce qu'il ne s'agit pas de l'opposition des genres entre eux et/ou de la dévalorisation de l'un par à l'autre__
* Celle-là, quand on veut l'embrasser sur les deux joues, il est plus court de passer par derrière.... ''Tristan Bernard''.
** Sûrement, parce que moi j'ai encore la mienne ! ''Coluche''.
* J'attends une vraie bonne occasion d'offrir des fleurs à ma femme. Son enterrement par exemple... ''Benny Hill''
* Je dois avouer que, lors de mon divorce, les torts étaient partagés: 50% des torts à ma femme et 50% à sa mère. ''François Olléry''.
* Je suis parti à Lourdes avec ma femme. Il n'y pas eu de miracle, je suis revenu avec. ''Seymour Brussel''.
* Les femmes c'est comme les téléphones mobiles, ceux des autres paraissent toujours plus perfectionnés
* On compare souvent le mariage à une loterie. C'est une erreur car, à la loterie on peut parfois gagner. ''George Bernard Shaw''.
* Ne convient pas __Parce que même au second degré ce n'est pas drôle__ : --µet alors ? la condition n'est pas que ça soit drôle mais que ça soit sexiste (et révoltant)µ
** - la rébellion de la femme par rapport au mari
** - la rébellion par rapport à Dieu
* A part peut-être Madame Thatcher
** [la suite pour ceux que ça intéresse|http://www.paroles.net/chansons/18447.htm]
*** parce le Tachan il n'a pas compris tout le film...
*µµListe initialisée par King_of_raidesµµ
ListeDeMains
/*Par pitié de mettez pas de lien vers des grosses mimines ! Merci
%%Center(µµLe Zouave par Van Goghµµ)%%
* Les Mains sales (de Jean-Sol Partre)
Liste créée par Kindofblue %%% (des deux mains)
ListeDeCons
/* par PITIE ne mettez pas de liens vers de GROS cons. merci
%%Center(enfin, une sélection, parce que si on les listait tous, je ne vous dis pas le bug)%%
* Ce n'est pas parce que 10 000 perroquets répètent la même connerie, que ce n'est pas une connerie.
* Deux hommes intelligents, d'idées opposées, trouvent beaucoup plus de choses à se dire que deux cons appartenant à un même parti. ''Frédéric Dard''
* Être traité de con par un autre con ne prouve pas que vous n'en soyez pas un. ''Yvan Audouard''
* Faut pas parler aux cons, ça les instruit. ''Michel Audiard''
* Gardons-nous de donner la parole aux cons. Ils ne veulent jamais la rendre. ''Philippe Bouvard''
* Il vaut mieux se taire et passer pour un con plutôt que de parler et de ne laisser aucun doute sur le sujet. ''[Pierre Desproges|ListeDesproges]''
* Il y a peu de chances qu'on détrône [le Roi des cons|http://www.paroles.net/chansons/21321.htm][http://www.afcinema.com/IMG/filmon9198.jpg]
* L'été : les vieux cons sont à Deauville, les putes à Saint-Tropez et les autres sont en voiture un peu partout. ''Michel Audiard''
* La connerie absolue n'existe pas car, à partir d'un certain degré, le con cesse d'être rentable. ''Yvan Audouard''
* La mort, c'est un peu comme une connerie. Le mort, lui, il ne sait pas qu'il est mort. Ce sont les autres qui sont tristes. Le con, c'est pareil. ''Philippe Geluck''
* Les sportifs, le temps qu'ils passent à courir, ils le passent pas à se demander pourquoi ils courent. Et après on s'étonne, qu'ils soient aussi cons à l'arrivée qu'au départ ! ''Coluche''
* Rien n'est plus voluptueux pour un pas con que d'être pris pour un con par un con. ''Frédéric Dard''
* Tous les ans il y a de plus en plus de cons, mais cette année j'ai l'impression que les cons de l'année prochaine sont déjà là. [Francis Blanche|ListepourFrancisBlanche] (µµattribué parfois et sans doute à tort à Audiard, Desproges, Coluche, Timsit...) */merci de laisser cette précision, la règle de ce wiki étant que l'on efface rien !
*en parlant des cons: "encouragez les bactéries, c'est la seule culture que certains connaissent!!!" (traduit de l'anglais)
![Con|ListeDeCons]paraisons
*** ''pardon, mais on dit HAUT comme 2 (ou 3) bites à genoux ; CON, c'est tout à fait une autre échelle de grandeur...''
**Le dossier "con". µµPour les heureux utilisateurs de Windows : essayez de créer un nouveau dossier et de le baptiser "con".... - Par contre "conasse", "connard", "cul" ça le fait très bien ! :)µµ
* Un autre livre [http://photos1.blogger.com/x/blogger2/3463/376341477376649/240/176004/gse_multipart46161.png]
[http://www.lsrhs.net/departments/language/GalanoM/MAINSITE/cinema%20site/images/le%20diner%20de%20cons%20poster.jpg]
ListeDeFilles
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Celle [aux bas nylon|http://jazz.chansons.free.fr/paroles/clerc/clerc_fille_au_bas_denylons.htm]
* Celle du coupeur de [joints|http://www.parolesmania.com/paroles_thiefaine_9403/paroles_la_fille_du_coupeur_de_joints_332351.html]
* Celle du Père [Noël|http://www.ojegou.com/partitions/index.asp?Idpartition=27&IdChanteur=11]
* Celle [folle|http://www.paroles.net/chansons/14948.htm], amante du vent
* [Celle|http://chansonplus.free.fr/paroles/paroles_text.php?id=37] qu'avait plus d'doigts
* Celles du pays de [Yves Caumon|http://www.lacinemathequedetoulouse.com/films/index.php?m=f&id=396] ou [Enrico Macias|http://www.paroles.net/chansons/15099.htm]
* Celles du [Calvaire|http://fr.wikipedia.org/wiki/Filles_du_Calvaire], assaisonnées par [Lucie Faure|http://www.bibliopoche.com/auteur/Lucie_Faure/7843.html]
* Les deux qui sont en [moi|http://www.paroles.net/chansons/15992.htm]
* [Sous les jupes|http://www.paroles.net/chansons/22128.htm] des filles
** µc'est bien pour cela que j'ai employé le terme "planqué" (parce qu'elles ne sont plus en évidence), mais bon, on ne va pas se battre pour ça ! bye ! :-)µ
ListedeSegolènes
* Madame une gaffe par jour (enfin les jours creux)
** ''Une femme sur trois est assassinée par son mari'' (discours de Romorantin, elle l'a ensuite [répété à la télé|http://cedroc.blogspot.com/2007/02/une-bourde-royale.html])
** µµQuestion : et quel taux de maris assommés par leur femme ?µµ
* [Bernard Hanse|http://desirsdavenir.over-blog.com/article-1870012.html], un lien curieusement disparu...
** µAttendez, si c'est son pays, moi je suis le Pape ! Elle est née à Dakar et a été élevée en Lorraine. C'est la vieille Mimitte qui l'a parachutée là. Ah que mais !µ
* ''Les enfants ne mentent jamais'', [déclaration|http://www.dailymotion.com/video/xtkrl_royaldifamation3] inoubliable dont elle ne parle plus trop
/* pitié arrétez de mettre des images nulles (LW)
** µParce que c'est plus tarte (cf infra).µ
* Rendez-vous est pris pour le 2 mai à 20 heures : confrontation entre les deux candidats sur TF1, arbitrée par Patrick Poivre et Chazal Claire. Les états-majors ont négocié pied à pied la couleur des rideaux, la forme des chaises, etc. Tout est prêt.
* La candidate s'explique le lendemain dans Métro et Le Parisien : "J'étais au chevet de la standardiste d'une usine de chaussures de la Creuse qui avait été mordue par son chien. Je suis une femme libre, je sais quelles sont les priorités. Les Français ne s'y tromperont pas !".
Notule historique : à l'heure où une [élection|http://www.gbrougnard2007.com] importante se prépare, il ne parait pas inutile de souligner que le wiki fut un des premiers, sinon le premier, à consacrer une page à Ségolaine. Peut-être en seront nous récompensés, dans un futur proche (LW)
Liste démarrée par Kind_of_je-sais-même-plus ! (la tehon) - µpourquoi tant de haine ?µ
ListedArtistesHipHopDecedes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* KLR du Saïan supa crew (accident de voiture). KLR étant à l'origine du groupe OFX, groupe de base faisant parti du collectif Saïan.
* Charlie Parker (artiste be-bop)
ListeDeMotsQuonComprendPasMaisQuOnAimeBien
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* ''abscons'' : inintelligible, sibyllin, incompréhensible, ésotérique, abstrait, énigmatique. Commune du département du Nord, près de Denain et de Valenciennes
* ''Anaphore'' : Répétition de débuts de phrases identiques dans un texte : ''[Je ne peux pas travailler|ListeDeJeNePeuxPasTravailler] debout parce que ça me fait mal aux g'noux/Je ne peux pas travailler assis, ça me fait mal au coccyx/Je ne peux pas travailler en boîte, j'ai les poumons comme de l'ouate.)''
* ''aprosexie'' : Mot trompeur : L'aprosexie n'est ni une apprentie, ni une professionnelle particulièrement aguichante, ce n'est pas non plus quelqu'un d'approximativement sexy, mais la difficulté ou l'incapacité de fixer son attention ou de se concentrer, ce qui n'a vraiment rien... de sexy !
* ''Boulingrin'' : Parterre de gazon. ''Sylvio et Natacha forniquaient sur un boulingrin...''
* ''Brimborion'' : Petit objet dérisoire (Molière). Par extension, pénis sans intérêt. ''Range-moi ce ridicule petit brimborion/Je préfère mon godemiché sans morpions !'', testicules ''qui ont l'art de pendre à la queue de l'homme comme les pompons à la tête d'un mulet.'' (Delvaux) ou clitoris (Rabelais)
* ''chat-pard'' : autre nom du lynx du Portugal. (un rapport avec chaparder mais pourquoi ?)
* ''Chibouk'' : sorte de [pipe|ListeDeeReapparus]
* ''clinamen'' : ''Pour les épicuriens, l’univers était constitué d’atomes aux trajectoires verticales et parallèles. Dans cette conception du monde, jamais rien n’aurait été créé, s’il n’y avait une déclinaison (ou __clinamen__) dans le mouvement des atomes, permettant la rencontre de ceux-ci, et par suite l’existence de toute chose. C’est sur l’existence de cette infime modification de la trajectoire des atomes que se fondent à la fois toute création et la possibilité pour tout être humain d’être libre.''
* ''cyprine :'' Liquide sécrété par le sexe de la femme pendant l'excitation. ''(Mot toujours inconnu du petit Larousse)''
* ''Dandinette'' : 1) Petit poisson factice et garni d'hameçons utilisé pour la pêche à la ligne. 2) homosexuel (éventuellement pêcheur). ''Tu pars encore pour la pêche avec ta dandinette ?''[http://lemomo2.pagesperso-orange.fr/Surf/dandinette.jpg]
* ''débellateur'' : Celui qui se bat victorieusement contre quelqu'un ou quelque chose. ''Le Paris Saint Germain fut le débellateur de Toulouse.''
* ''Debunker'' : Anglicisme. Démystifier de façon sceptique, les légendes liées aux OVNIs, aux phénomènes paranormaux, aux apparitions mystiques, aux pseudos-sciences, aux théories du complot...
* ''diacritique'' : (adjectif) Signe que l’on ajoute à une lettre pour lui conférer une sonorité particulière (en français : les accents aigu, grave et circonflexe, le tréma et la cédille.)
* ''Dulie'' : Adoration des saints. (à ne pas confondre avec la mammophilie qui est l'adoration des seins) Voir aussi Hyperdulie. µµLes catholiques et les orthodoxes n'emploieraient pas le mot adoration mais celui de vénération. En effet on ne doit adorer qu'un seul Dieu (malgré le fait qu'il soit trois !) D'ou un mot spécial pour désigner l'adoration des saints. Mais la Vierge Marie, dans tout ça ? Sa vénération étant supérieure à celle des autres saints, on parlera donc d'hyperdulie !µµ
* ''dumicole'' : Qui vit dans les taillis, dans les buissons. (et par extension : qui s'y cache). ''L'inspecteur Fougnard suggéra que l'exhibitionniste de la RD314 était très probablement dumicole''
* ''églogue'' : poème bucolique. Guy de Maupassant est par exemple l'auteur d'une "[églogue bien amoureuse|http://wp.vassilia.net/histoires/eglogue-bien-amoureuse]" fort croustillante
* ''[épectase|ListeDeGensMortsEnFaisantlAmour]'' : Décès pendant l'orgasme. Epectases célèbres : Le pape Pie IV en 1565. En 1899, Félix Faure, président de la république française au palais de l'Elysée dans les bras de Marguerite Steinheil, courtisane de haut vol, que la domesticité fit précipitamment sortir des lieux par une porte dérobée. En 1974, le Cardinal Daniélou (de l'Académie française) dans les bras d'une prostituée et en son studio de passe dans le quartier de la rue St Denis, à Paris.
* ''Exhilarant'' : Propre à ég&#97;yer ! Ce mot utilisé par Rabelais et Molière (mais aussi par Artaud et Claudel) était considéré comme "vieilli". Il réapparait aujourd'hui sur... la collerette des bouteilles d'eau de Badoit™
* ''exponcher'' : Indiquer par des points qu'une lettre ou un mot doit être retranché d'un manuscrit.
* ''Giallo'' : Genre cinématographique qui fut en vogue en Italie à partir des années 1960 et dont la composition est quelque chose comme 50% de policier, 40% d'horreur ou de fantastique et 10 % d'érotisme. Parmi les réalisateurs ayant popularisé ce genre, citons Mario Bava et Dario Argento.
* ''Gibbeux'' : Bossu (et qu'on nous explique pourquoi mettre deux "b" ?) Ne s'utilise plus que pour qualifier [la Lune|ListeLunaire] qui est gibbeuse quand son apparence est entre la pleine lune et le quartier (qu'il soit premier ou dernier)[http://lemomo2.pagesperso-orange.fr/Cosmos/Lune_gibbeuse.jpg]
* ''Gimblette'' : Petite pâtisserie en forme d'anneau parfumée aux amandes (spécialité albigeoise). Sur un tableau de Fragonard (1732-1806), une jeune fille tient une gimblette dans sa main gauche, d'où le titre du tableau. Une gimblette n'est donc pas une jeune femme couchée, à moitié nue et jouant à soulever son chien de compagnie en relevant les pieds. (bien que le terme ait été repris par d'autres peintres ou sculpteurs...)[http://lenaweb.voila.net/images/La_Gimblette_Fragonnard.jpg]
* ''Gomorhéen'' : mot forgé par Proust par imitation de "sodomite" et allusion à l'histoire biblique de Sodome et Gomorrhe : caractéristique de la sexualité homosexuelle féminine. Synonymes : lesbien, saphique.
* ''gonzo'' : Désignait l'une des marionnettes du Muppet-Show (crée par Jim Henson de 1976 à 1981 et qualifie aujourd'hui les films X dénués de tout scénario. Personne ne semble en mesure d'expliquer cet étonnant glissement sémantique.[http://lassilia.voila.net/Bonus/Gonzo.jpg]
* ''gymnophoria'' : C'est la sensation de se sentir déshabiller mentalement par autrui. ''µC'est fini, j'prend plus le métro, c'est trop la gymnophoria !µ''
**µµhécatonchire n'a pas été trouvé dans une entrée du TLF. Le logiciel a donc décidé d'activer son correcteur d'erreurs pour rechercher hécatonchire et les mots apparentés dans tout le texte du TLF. hécatonchire n'a été trouvé nulle part dans le TLF. Aucun mot apparenté n'a été trouvé. L'échec de la recherche peut être dû à différents facteurs: %%%La façon dont vous tapé le mot est trop éloignée à la fois de l'orthographe et de la phonétique d'un mot connu.%%%Le mot est un nom propre. Nous vous rappelons que le TLF est un dictionnaire de la langue française et non un dictionnaire à vocation encyclopédique. Il ne contient donc pas de noms propres.%%%Le mot est apparu trop récemment pour être répertorié dans le TLF, ou il s'agit d'un mot trop particulier (mot argotique, mot étranger, mot appartenant à une spécialité scientifique pointue, etc.)µµ
* ''hyperdulie'' : Vénération de la Vierge Marie dans les cultes catholiques et orthodoxes. Celle-ci revêt parfois la forme d'une névrose obsessionnelle marquée sexuellement. Ainsi [St Bernard de Clairvaux|http://marjorie-art.voila.net/Drole_de_saints.htm] (1090-1153) fantasmait sur les seins de la vierge, à un tel point qu'il a halluciné et affirmé que par miracle la Vierge lui était apparue, avait pressé son sein et lui avait envoyé son lait maternel en pleine poire. Voir aussi Dulie.
* ''hypostase'' : Remplacement d'un terme appartenant à une catégorie grammaticale par un terme appartenant à une autre catégorie grammaticale. (par ex : un verbe employé à la place d'un nom...) ''Je lui ai fait un __tripoter__ du nombril''
* ''indéfectible'' : perpétuel. ''Paris Hilton et son indéfectible chihuahua''
* ''inflorescence'' : définit la répartition générale des fleurs sur la tige d'une plante.
* ''Latébreux'' : Retiré, isolé. ''Cette baraque latébreuse, miséreuse, hideuse était habitée par deux gueuses.''
* ''logorrhée'' : incontinence verbale. (parler de logorrhée verbale est donc un pléonasme)
* ''lucifuge'' : Qui fuit la lumière. Lucifuge Rofocale est selon Le Grand Grimoire, le premier ministre des Enfers et celui qui l'invoque peut signer des pactes avec lui. ''(par exemple un contrat de confiance !)''
* ''maltôte'' : surnom donné à un impôt créée par Philippe le Bel et considéré comme injuste
* ''mésomorphe'' : Individu se distinguant d'abord par sa musculature. ''Stalonne, Schwarzenegger, [Van Damme|ListeDeJeanClaudeVanDamme], [Tarzan|ListeDeTarzan]...''
* ''météorisme'' : Gonflement du ventre provoqué par la présence de gaz dans les intestins. Ne pas confondre avec météoritisme.
* ''morigéner'' : réprimander ''Je me suis fait morigéner par ma régulière !''
* ''mortaise:'' Entaille pratiquée dans une pièce de bois (par ex) pour y emboiter le tenon d’une autre pièce [http://www.bois.com/media/214351/prinicipe-assemblage1.jpg]
* ''neume'' : Notation musicale moyenâgeuse (ancêtre de nos partitions).
* ''Nicolaïsme'' : Mot désignant au moyen âge l'incontinence des prêtres. Cette incontinence ne posait pas un problème moral comme on le croit généralement (le péché de chair était à l'époque considéré avec indulgence) mais économique, le partage des biens de prêtres mariés aux profits des héritiers était considéré par l'église comme une dilapidation de ses propres biens.
* ''nuncupation'' : Déclaration faite par le rédacteur d'un testament devant témoins pour désigner ses héritiers. ''(et non pas occupation de nonnes)''
* ''oréades'' : nymphes des montagnes et des grottes. Par contre "marasmius oreades", c'est un champignon ! [http://champignons.easy4blog.com/images/billets/0129/129011.jpg]
* ''pallikare'': Milicien grec ou albanais au service des turcs (pendant la période d'occupation de la Grèce par l'empire ottoman)
* ''Paradigme'' : Façon de voir les choses, système de pensée
* ''Paraguanter'' : Epingle de corset
* ''parangon'' : Modèle absolu et incontesté, archétype ''Le Chabanais était le parangon des maisons de filles de petites vertus''
* ''parapétasme'' : Grand rideau qui à l'intérieur d'un temple était placé devant la statue de la divinité. Par analogie : rideau de théâtre
* ''Paronymes'' : Mots qui se ressemblent beaucoup mais qui ne veulent pas dire la même chose (comme tendresse et tendreté)
* ''passalorynchite'' : Membre d'une secte chrétienne ayant fait vœu de silence perpétuel. Semblent disparus de la circulation en raison d'un problème de recrutement car comment expliquer les réglés aux néophytes sans briser son vœu ?
* ''[pitch|ListeDeGrandsRecitsResumesEnUnePhrase]'' : Phrase ou court paragraphe résumant un film, un roman, une pièce de théâtre... Exemple Le Pitch de Tangy (film d'Etienne Chatilliez) serait ''Un "adolescent attardé", assisté, branleur et prétentieux insupporte sa maman et encore plus son papa.''
* ''Porphyrogénète'' : Né alors que le père est empereur byzantin. (la chambre d'accouchement était nommée porphyra car garni de blocs de pourpre égyptiens). Par extension, fils de souverain devenus tyranniques. (pas trop facile à placer dans une conversation)
* ''Prétérition'' : Figure de style où l'on commence par indiquer qu'on ne veut pas exprimer ce qui est néanmoins exposé dans la suite de la phrase ou du discours. ''La Ginette, elle fait ce qu'elle veut, moi je ne juge jamais les gens, mais quelle salope quand même !'' ou le classique ''Richard Wagner, pour ne pas le nommer''
* ''Primipare :'' Se dit d'une femelle qui accouche pour la première fois
* ''Quoailler'' : Remuer continuellement la queue (en parlant d'un cheval).
* ''scorpionite'' : mal qui consiste à "nous envenimer". (inventé par François Fillon le 9/1/2012)
* ''souleur'' : Frayeur subite. (et non pas personne qui soule les autres) ''L'apparition du fantôme de l'Opéra lui provoqua une souleur''
* ''spartier'' (nom complet : spartier à tiges de jonc) : autre nom du genêt d'Espagne
* ''spermophile'' : (du grec sperma "semence, graine" et philos "amateur") 1 ) rongeur de la famille des écureuils vivant en Amérique du Nord (appelé aussi souslik ou écureuil terrestre). 2) Adepte de la spermophilie : Excitation/Fascination produite par la vue du sperme (et par extension de sa manipulation et de son ingestion). [http://www.culture-generale.fr/wp-content/uploads/spermo.jpg]
* ''spin-off'' : œuvre de fiction où un ou plusieurs personnages secondaires d'une œuvre précédente deviennent les personnages principaux. Par exemple les aventures de [schtroumpfs|ListeDeSchtroumpfs] sont des spin-off de Johan et Pilouit.
* ''stolon'' : tige végétale de certaines plantes qu'on repique en terre sans la couper pour la reproduire (par exemple les fraisiers)
* ''Survival'' : Sous genre du film de terreur dans lequel les membres d'un petit groupe vont se faire décimer par un ''(ou plusieurs)'' tueur fou ''(voir aussi slasher)'', conglomérat gélatineux, [esprit frappeur| ListeFantome], [mutant|ListeDeMutants] dégénéré, [extraterrestre|ListedExtraTerrestres] pas sympa, disciple de Ben Laden, [adorateur de Frigide Barjot|ListePourFaireUnDictionnaireDeLaManifPourTous]... (liste non limitative). A la fin du film suivant les cas il ne reste qu'un survivant (ce qui permet de faire une suite), parfois un couple, parfois personne.
* ''syndérèse'' : partie la plus élevée de l'âme (ce qui nous permet d'apprendre au passage que les âmes ont des niveaux !) Syndérèse de l'Enfant Jésus !
* ''Syneisaktisme'' : Forme de mortification pratiquée par des moines consistant en une promiscuité chaste avec une (ou plusieurs) femmes.
* ''Tenon'' : Partie mâle d'une pièce d'assemblage destinée à être enfoncée dans la partie femelle d'une autre pièce (mortaise)[http://www.bois.com/media/214351/prinicipe-assemblage1.jpg]
* ''thuriféraire'' : dans la liturgie catholique, le thuriféraire porte l'encensoir. Par extension : vil flatteur, flagorneur, lèche-cul...
* ''thaumaturge'' : faiseur de miracle ''et non pas tomates cultivées dans l'urgence''. ''Robert jouait les thaumaturges à la Foire de Paris.''
* ''trimammophilie'' : Fantasme ou intérêt particulier pour les femmes à trois seins et aux légendes et anecdotes s'y rapportant
* ''tripudier'' : Danser, sauter de joie. (Scaron l'orthographia "trépudier" par erreur) ''En apprenant que son marlou était enfin libéré, Ginette tripudia''
* ''Tumulus :'' Amas de terre recouvrant une sépulture, un dolmen par exemple
* ''tympe'' : Pierre de maçonnerie, sur la partie frontale d'un fourneau de forge.
* ''Vacuité'': Etat de ce qui est vide alors que ça pourrait être plein (parce qu'on ne dit pas "vidisme", "vidaison", "viditude". ''Constatant la vacuité du verre de son client ivrogne, le barman refusant de le remplir de nouveau, lui dit simplement : va cuiter !''
* ''verbigération'' : Trouble du langage caractérisé par une abondance de paroles vides de sens.
* ''vulgivaguibilité'' : (de vulgivaguibus : qui erre partout, vagabond) mettre sexuellement à disposition de la communauté. ''Singha, reine d'Angola, avait fait une loi qui établissait la vulgivaguibilité des femmes. (Sade, Juliette)'' Attention c'est un néologisme inventé par Sade, ce n'est pas un vrai mot !!
** Machine pour creuser la terre sous l'eau. µPar exemple pour construire un [pont|ListeDePonts].µ
* ''zooredondants'' : Qui (se) recopient bêtement les uns les autres (en parlant des sites internet)
* ''zythum'' : Sorte de bière dans l'Egypte antique. µ(tout bon dictionnaire se doit de finir par lui)µ
* ''xénie'' : Phénomène de double fécondation par lequel l'albumen d'une graine présente des caractères génétiques paternels lorsque la pollinisation a été effectuée par un pollen étranger (très clair !)
*abligurition ? µ- T'es sûr que ça existe en français ?µ Apparemment c'est de l'anglais :''Prodigal expense for food''.
* Bravitude - on l'aime bien ce mot, mais on le comprend parfaitement
* ''aphérèse'' : tout ce que je sais, c'est que l'aphérèse est un métaplasme s'opposant à l'apocope, et que Raymond Queneau en a fait un de ses exercices de style. il faut dire qu'il faisait partie de l'Oulipo, et ne négligeait ni les litotes, ni les synchyses, ni les homéotéleutes, ni les onomatopées, ni les polyptotes, ni les syncopes, ni les paréchèses, ni les lipogrammes, ni les prosthèses, ni les épenthèses, ni les paragoges, ni les métathèses, et ne négligeait pas non plus les contrepèteries.
* "primipare" était inconnu ? On voit que le listeur est surtout masculin :-)
µListe proposée par Gilles R. - participation involontaire(?) de Philippe De Jonckheere µvoir aussi la ListeCourteµ
ListePerdue
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* ''Le petit Roger a perdu ses parents et les attend au stand Ricard''
* Les ''Paradis Perdus''
ListedeChosesquiFontPeur
/* par PITIE ne mettez pas de liens vers de GROSSES trouilles. merci
* L'__écume des jours__ (Boris Vian) (?) µµ''Partie du site protégée; pour y accéder, veuillez appeler le numéro de téléphone mentionné ci-dessous, ce coup de téléphone vous communiquera un code d'accès au site. Ces mesures sont prises afin de rembourser en partie le temps passé à la maintenance du site et à son amélioration.''µµ
* La __grande roue__ du parc Astérix [http://www.ecole-plus.com/dessin(4)/MANEGES/GRANDE%20ROUE.JPG]
* Le __niveau de débilité__ satisfaite déjà atteint par la télé, et qui donne un aperçu de ce que peut être l'infini
* __[La parlotte|http://lespoetes.net/blog/post/Christ/1000/LD--Le-Dsert]__
** µµsurtout quand il faut les ressusciter par ''massage cardiaque''..µµ
* __Simone Broussette__ quand elle dit qu'elle me parle pas de mon ex
* __Simone Broussette__ quand elle me parle de mon ex
µµListe créée par S.µµ
ListeDeeReapparus
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListedeNomsGeographiquesquiFontRevermaispasdesVilles
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* (Le mont) Parnasse
Liste proposée et initialisée par S. - µcomme pour l'autre liste, c'est plutôt la beauté du nom, ou sa force évocatrice, qui comptent...µ
ListeDeNenJetezPlus
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**non ! ce ne sont que des constatations objectives (objectives ? Et pourquoi ne mentionner que ce qui augmente et non ce qui diminue : moins de 5000 tués sur les routes en 2005 par exemple...), les remarques qui suivent ne le sont pas toujours...
***La constatation est parfois objective mais l'accumulation ne l'est pas. Cette liste est politisée alors qu'Echolalie ne l'est pas ou ne devrait pas l'être).
*diminution de la durée de l'allocation spécifique de solidarité, versée par l'État aux chômeurs en fin de droit
*Relèvement de 2,5 centimes par litre de la taxe intérieure de consommation sur les produits pétroliers applicable au gazole, mesure qui devrait rapporter environ 800 millions d'euros.
**Par les temps qui courent...
**(Par les temps qui courent...)
**c'est vrai que la pollution, on n'en parle même plus...
****c'est vrai : remplacer des gens inutiles par des gens qui ne font rien ? Je ne vois pas le progrès...
*plan d'épargne populaire (PEP) supprimé
ListedeChosesanepasConfondre
/* par PITIE ne mettez pas de liens vers de GROSSES confondations. merci
* La philanthropie de l'ouvrier-charpentier et la tripe en folie de l'ouvrier partant chier
* Le ramadan et Halloween µ(même si cette année ça tombe pareil. C'est pas le même catéchisme)µ [http://www.travelbookmark.com/cards/hallowen-mostri.jpg]
* Les Parnassiens et les pharmaciens
* L'abricot et la figue (en fait c'est pareil)
* Jean Poldeux et un singe empaillé µ(même si les niveaux de conscience et de mobilité sont comparables)µ
* ''Star Académie'' et ''Graines de stars'' - µenfin, en cas de confusion, c'est pas trop grave, la terre continuera de tourner... (au reste, moi-même, n'ayant vu aucune des deux, je ne fais pas bien la différence - alors pourquoi tu en parles ?- pasque c'est à ce point nullard, c'qui paraît, que le type qu'à inventé la tété, il s'en mord les bonbons - Euh, j'voulais écrire "télé" mais mon doigt a fourché) -- donc tu n'a pas vu les choses dont tu parles et tu te fies au c'qui paraît... belle leçon d'intelligence ! - Ben j'ai pas vu De Gaulle non plus, ni Napoléon d'ailleurs - quel rapport ?µ
*µµListe proposée et initialisée par S. (µà ne pas confondre avec Solµ) - (facile) -- certes, mais elle n'est pas de moi - voir ListedeCommeDiraitµµ
ListeAmbigue
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
**''J’ai appris une anecdote qui prouve jusqu'à quel point il portait attention pour ne rien faire qui le trahit. Le ministre Anglais curieux de reconnaître quel était réellement son sexe, le faisait suivre et surveiller dans ses moindres actions. L’habitude du chevalier Déon était d’aller se promener seul le soir au parc ; les gens qui l’observent le surprirent à différentes reprises s’accroupissant comme le ferait une femme; c’est le rapport qui fut fait à cet égard qui contribua le plus à tromper sur son sexe jusqu’au dernier moment.''[http://www.nodulo.org/ec/2004/img/n034p18m.jpg]
**Erratum : Yasmina Khadra est le pseudonyme de l'écrivain Mohammed Moulessehoul, né le 10 janvier 1955 à Kenadsa dans la wilaya de Bechar dans le Sahara algérien. Ses œuvres ont été traduites en plus de trente langues. Il choisit de rendre hommage aux femmes algériennes et à son épouse en particulier, en prenant ses deux prénoms : Yasmina Khadra. il ne révèle son identité masculine qu'en 2001 avec la parution de son roman autobiographique L'Écrivain et son identité tout entière dans L'imposture des mots en 2002. Or à cette époque ses romans ont déjà touché un grand nombre de lecteurs et de critiques.
µµreclassée par les Comptoirs Commerciaux du Caoutchouc, 13 bis bd Hausmann, Paris 9e -- catalogue gratuit sur simple demande accompagnée d'une enveloppe timbrée - restaurée après sabotage de Jane le 27/3µµ
ListeDeTouristesDelEspace
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
# __Toyohiro Akiyama__ journaliste japonais, il est le premier astronaute non professionnel envoyé dans l'espace. (Sur Soyouz TM 11) Sa participation a été financé par une chaîne de télévision nippone. (décembre 1990)[http://www.space-explorers-scotland.com/images-visitors/toyohiro-akiyama.jpg]
* Savinien __Cyrano de Bergerac__ auteur de l’Autre Monde (1657), œuvre considérée comme un des premiers romans de science-fiction, qui s'articule en deux parties : Histoire comique des Estats et empires de la Lune et Histoire comique des Estats et empires du Soleil, où est décrit à la première personne un voyage dans la Lune et le Soleil.
*Les bonnes paroles de Tonton Wikipedia
** Le tourisme spatial est le tourisme qui concerne l'espace. %%%Il est apparu au début du XXIe siècle, et est bien sûr réservé aux personnes particulièrement fortunées.
** Oui, car il y va en auto-stop (pardon, en navette-stop)
* Précisons pour l'"analphabète de service" qu'un touriste est quelqu'un qui voyage pour son agrément, le fait de payer sa place ou non ne rentre pas en ligne de compte. Ainsi, par exemple, un auto-stoppeur (rare dans l'espace il est vrai), peut être un touriste...
* Reprécisons @@au gros crétin@@ à celui qui viens mettre américain à la place de étasunien, que étasunien est le choix du créateur de cette liste. Alors @@Ouste dégage@@ ! Merci de laisser la dénomination choisie par le créateur de la liste.
* et bien sûr la ListeDeCons µµy sont partout !µµ
Liste lancée en l'air par JoZgur
ListedeNeConvientPas
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Entrer dans un lieu de culte avec un parapluie ouvert ou avec un animal domestique (même si celui-ci est tenu en laisse)
* Attendre que Monsieur soit juste parti au bureau, pour s'envoyer le voisin du dessus, très beau, très sportif et qui a de si jolis yeux, bleus comme l'azur...
** Moi je ne trouve pas que ce soit avilissant, sauf que les seins de la meuf tombent - %%Red(µAvez-vous entendu parler d'un certain ''Isaac Newton'', et de la ''gravitation universelle'' ?µ)%% -, et que notre Ouaibemestre bien vénéré (et bien membré au demeurant) ne se dégraderait pas à fréquenter ce genre de créatures, ce qui prouve bien, CQFD - qu'il s'agit bien d'un grossier montage.
* Aller faire cours en string sous son scaphandre - µet une coiffe bigouden par dessus !µ
* Célébrer le saint office en string léopard sous sa soutane
* Liste proposée et amorcée par S., qui s'arrête avant de s'emmêler les pinceaux
ListeDeJoursDelAnneaFeter
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* la fête des êtres parfaits (18 avril - farpaitement)
* la fête des [filles de joie|ListeDeParolesdEscorts] (le 22 juillet, jour de la Ste Marie-Madeleine, sainte patronne de la profession)
* La fête des grand-mères µµdate fixée par la chambre syndicale des fleuristes et variable suivant les contréesµµ
* La fête des mères µµdate fixée par la chambre syndicale des fleuristes et variable suivant les contréesµµ
* La fête des pères µµdate fixée par ??? variable suivant les contréesµµ
* La fête des secrétaires µµdate fixé par la chambre syndicale des fleuristes et variable suivant les contréesµµ [http://pagesperso-orange.fr/lemomo2/Horizontal_Secretary.jpg]
*µµListe magnifiquement créée par El Jj et qui l'a complètement oublié... :-)µµ
ListeDeTypesDeBlagues
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Parce qu'ils n'ont pas peur du vide
**Parce qu'elles les font rire trois fois :
** Parce qu´il se croisent tous les matins aux garage.
** La fonction, parce le logarithme népérien
** ex : Mon premier est la seizième lettre de l'alphabet. Mon deuxième est ce que font les bébés après le biberon. Mon troisième est l'endroit ou les passagers attendent le train. Mon tout est un oiseau qui parle trop! Qui suis-je ?
Liste créée par El Jj - µ'[tain|ListeDeTain], il est fort cet El Jj (mais pas en ortografe) !µ
ListedHommesobjets
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Que ferais-je de vous mon homme objet / Que ferais-je de de tout ce beau palais /De grands muscles si doux et si parfaits ''Brigitte Fontaine''
ListeDeConventionsTacites
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* ne pas parler de Proust au travail
** Faux Sol ! Au Tango on danse dans le sens contraire... Peut-être parce que cette danse est née dans l'hémisphère sud (pseudo principe de la vidange du lavabo) [http://dance.iatp.by/images/waltz.jpg]
* à partir d'un certain nombre entassés dans le métro (nombre de gens au m² ?) se lever de son strapontin
* se répartir les mêmes places suivant l'ordre d'arrivée dans un ascenseur et, entre les étages, regarder fixement la porte
* tenir sa droite en marchant, en nageant, en croisant un caddie dans un super marché, en se laissant porter par un escalator ou par un tapis roulant.
** pour les bagnoles et les rosbifs, ça me paraît pas si clair
ListedeCotes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Liste proposée et quotée par S. -- µµon a un peu enlevé le html qui ne fonctionne pas sur ce wikiµµ
ListeDeVie
/* par PITIE ne mettez pas de liens vers de GROSSES images.
* Au tamis de la vie, je n’ai gardé que les paillettes et tout le sable est parti au fil de l’eau ''Yvan Audouard''
* Si je me tue un jour (je ne promets rien pour l'instant), ce sera par amour de la vie. ''Guy Bedos''
En paraphrasant Jeanne Moreau (1er c'est la vie). (commencer uniquement par des __noms communs__, pas par des verbes,)
ListeDeTasDeBonnesRaisonsDetreUneFemme
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Personne ne vous demande de réparer le lavabo qui fuit
* Personne ne vous fait perdre tous vos moyens en dévoilant une partie de son corps
* Personne ne vous fait d'enfant dans le dos (Euh ! Ca reste à prouver, car le bas du dos est la chose au monde la mieux partagée)
* Vous savez lire et écrire µµ euh, enfin ça, ça dépend des femmes, l'illettrisme étant, hélas, un drame assez bien partagéµµ
* La compression résultant d'une addiction au cyclisme ne compromet pas votre ambition à avoir une forte descendance, et vous pouvez même en tirer parti.
* Vous pouvez décider d'arrêter de travailler, personne ne vous considérera avec pitié comme le dernier ramassis de poubelle d'incapable de lopette
* C'est un vrai bonheur d'avoir un cycle menstruel se manifestant tous les 28 jours par un détachement de la muqueuse utérine interne et un écoulement sanguin
* Vous paraissez moins ridicule qu'un homme lorsque votre voix mue.
ListeDavertissementsInscritsSurLesPaquetsDeCigarettes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*** µBen alors, c'est quand même trop tôt (à en croire la plupart des intéressés), et donc ''prématuré''µ
* Arrêter de fumer rend con µ(beaucoup d'exemples dans la première partie de cette page)µ
µµListe créée par El Jjµµ
ListeDeTrucsSuperDursQuandOnNaPlusQuUneMainValide
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
/*[http://www.nagasaki-gaigo.ac.jp/nufs/c_french/WebEnParoles/files_html/images_jpg/p62_1.jpg]
* taper sur un clavier à plus de 2 lettres par seconde
* aller au restaurant chinois sans maîtriser parfaitement les baguettes
b) d'en mettre partout
* faire une tarte aux pommes (je dis tarte aux pommes parce que c'est bon, la tarte aux pommes, mais j'aurai tout aussi bien pu dire chausson au chinchard)
* Interpréter le ''Concerto pour la main gauche'', écrit par le regretté Ravel à l'intention du non moins regretté Wittgenstein (frère du)
ListeAngevine
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* la boule de fort qui se joue sur un jeu pas droit avec des boules déséquilibrées par un morceau de plomb
* le parmesan
ListeBigourdane
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Le pays Bigourdan (La Bigorre) se situe au nord ouest du département des Hautes Pyrénées, ce comté français fut rattaché au Béarn au XVème siècle.
* Guillaume Bigourdan (1851 - 1932) astronome à l'observatoire de Paris et président de l'Académie des sciences. Il est connu pour sa méthode de mise en station des télescopes encore utilisée par de nombreux astronomes amateurs. Il découvrit l'[astéroïde|ListedAsteroides] Alma en 1894 (bien qu'il ne fut point zouave !)[http://www.pad-astrophoto.ch/media/Bigourdan_02.gif]
ListeChampenoise
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Le champagne [http://www.paris-champ.fr/uploads/2010/10/champagne-drappier-brut-carte-d-or-bouteille-magnum-jeroboam-mathusalem-balthazar-nabuchodonosor-primat-salomon-melchisedech.png]
* Sur la montagne de Reims, perdu quelque part au milieu des bois, un petit village s'appelle Germaine - il y a quelques habitants qui vivent là
* Rabbi Shlomo ben Itzhak HaTzarfati dit Rachi, également connu sous le nom de Salomon de Troyes, rabbin, exégète, légiste, décisionnaire, poète et vigneron (Troyes, c. 1040 - 13 juillet 1105). Principalement connu de nos jours pour son commentaire sur la quasi-totalité de la Bible hébraïque et du Talmud de Babylone, il est l’une des principales autorités rabbiniques du Moyen Âge et l’une des autorités les plus influentes du judaïsme. Il est aussi l’un des rares savants juifs à avoir influencé le monde chrétien, son exégèse biblique ayant influencé, par le truchement de Nicolas de Lyre, la traduction de la Bible par Martin Luther.
ListeAlsacienne
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Albert Schweitzer µ(oncle du regretté Jean-Sol Partre)µ
* La parlement européen
* Le Parlement européen
* Les concours de bagnoles brûlées ** µSolidement distancée par le 9-3 cette année !µ
* Pierre Pflimlin (1907-2000) - µmaire de Strasbourg et président du Conseil, ce qui explique que Strasbourg, et non Paris, ait été choisie comme capitale de l'Europe...µ µµ--de moins en moins capitale, d'ailleursµµ
* Les journaux paraissent le jour férié, mais pas le lendemain !!! (''ben voui, les distributeurs de journaux peuvent bosser le matin d'un jour férié, alors que les journalistes vont pas bosser...CQFD'')
* Les curés sont payés par la république.
ListeAquitaine
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Jacques Chaban-Delmas - le résistant en pardessus et peau de lapin
** µQue De Gaulle avait envoyé remettre un peu d'ordre dans une région libérée elle-même par des gars pas trop présentables - il ne se l'est pas fait répéter et y est resté 50 ans dans les conditions que l'on sait...µ
HommageaSol
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Para, Sol? Non, elle a le vertige.
ListeLyonnaise
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* La [rosette|ListeDeMotsRelatifsAlaPartiePosterieuredesHumains] et le Jésus
* Le [Beaujolais|http://www.beaujolais.net/] µ(pas le nouveau, réservé aux parisiens...)µ
* Le Parc de la Tête d'Or
* Les taxis lyonnais qui s'amusent à arnaquer les parisiens. (1 heure pour aller de Perrrache à Eculy !)
* ''Tout l'monde peuvent pas êt'de Lyon, Y en faut ben d'un peu partout''
* Si te veux pas te faire aggrafiner par le miron, ablage le donc, au lieu de l'coquer comme si c'était ta canante
* Charles Béraudier : (1920-1988), député du Rhône (1959-1962). Adjoint au maire de la ville de Lyon de (1957-1988). Président du Conseil régional de Rhône-Alpes (1981-1988). Le lieu de son malaise mortel aurait été arrangé par "correction" : dans la rue au lieu de la chambre d'une prostituée ([source|http://ruesdelyon.wysiup.net/PageRubrique.php?ID=1007505&rubID=1007679] ). Le maire de Lyon de l'époque, Francisque Collomb (droite) indiquant pour sa part que l'homme serait quasiment mort dans ses bras ! (sic)
* Felix Benoit : humoriste lyonnais, qui nous rappelle cette phrase, lyonnaise par essence, de Pierre-Hector Coollié, Cardinal archevêque de Lyon de 1893 à 1912, faite en chaire : non seulement Jésus-Christ etait fils de Dieu, mais il était d'excellente famille du côté de sa mère.
* Le [lycée du Parc|http://lyceeduparc.free.fr/]
Liste démarrée par Sergio µµ(Léone ? qui veut dire lion en Italien ?)µµ
ListesRegionales
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
C'est un peu trop, peut-être, non ? Et encore on s'est limité aux pays voisins... Mais c'est Jeg qui a commencé !%%% 'tain, il piqué mon idée, lui !.... :-) -- A quand la liste des départements, des communes, .. ça craint ..
ListePourRepasDpg
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
µ%%Red(Pourriez-vous fournir également le décodeur ?)%% -- je crois que c'est des anciens de [quelque part|http://www.echolalie.com/l1323.htm] qui vont se réunir un certain jour, dans un certain endroit --µ
* Repas Diplomatique Paroxistiquement Grave ?
ListeDexpressionsSynonymesContraires
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* "Avec personne"/"sans personne" (proposé par Rob R)
**µµPas d'accord, d'après le dico ; ivre : exalté par une passion. C'est donc le contraire de "tu me saoules" au sens casse-bonbon.µµ
Liste commencée par El Jj
ListeDesChosesEffectueesDansMaJourneeDeTravail
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** et de !?µ%#%µ§,&£$ remonter les étages parce qu'il n'y a plus d'argent sur la carte
** je vous le déconseille fortement : ça n'empêche pas l'éblouissemnt, par contre on a l'impression que le ciel est perpétuellemnt gris, c'est très néfaste pour le moral !!!
** il faut faire des devis avant de procéder aux réparations
** µOn peut-y la voir cette liste ? C'est pas parce que le Ouaibemestre est provisoirement "on leave" qu'il faut paresser.µ
%%Blue(''µµvécu par solµµ'')%%
ListePicarde
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Il faut dormir sur le parking
*Il faut rentrer sur Paris
* [Les roses de Picardie|http://www.lexode.com/keskidi/paroles-6798.html]
ListedInterjectionsPlusOuMoinsRidicules
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Tous les morbleus, tous les ventrebleus%%%Les sacrebleus et les cornegidouilles%%%Ainsi, parbleu, que les jarnibleus%%%Et les palsambleus%%%Tous les cristis, les ventres saint-gris%%%Les par ma barbe et les noms d´une pipe%%%Ainsi, pardi, que les sapristis%%%Et les sacristis%%%Sans oublier les jarnicotons%%%Les scrogneugneus et les bigr´s et les bougr´s%%%Les saperlottes, les cré nom de nom%%%Les pestes, et pouah, diantre, fichtre et foutre%%%Tous les Bon Dieu%%%Tous les vertudieux%%%Tonnerr´ de Brest et saperlipopette%%%Ainsi, pardieu, que les jarnidieux%%%Et les pasquedieux
(La Ronde Des Jurons par Plume Latraverse)
(La ronde des jurons par Sam Alpha)
** Parbleu
** Par ma barbe
** Pardi
** Pardon, chef.
Cette liste est le complément d'une entrée de [cette liste|ListeDeDisparus], qu'on trouve [ici|http://www.google.fr/search?hl=fr&ie=UTF-8&oe=UTF-8&q=disparus+morbleu&btnG=Recherche+Google&meta=cr%3DcountryFR]
Liste créée par El Jj
ListeDeParlerThai
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(__Liste de parler thaï__)%%
** Par ailleurs, ces diphtongues ou triphtongues ne sont pas toujours "logiques" dans le sens où l'association des lettres ne correspond pas forcément au son créé par cette association dans l'alphabet romain… Par exemple, le son "ao" est formé des voyelles de sonorités é+a.
** pour parler au Roi,
* Dans le langage parlé, certains mots sont suggérés. Par exemple, le pronom __je__ est souvent oublié.
* Toutes les phrases se terminent par "khrap" pour les hommes et "ka" pour les femmes.
** ''Parlez doucement s'il vous plait'' ka rou na pout cha cha
ListeExperimentaleEtSuccinteDuParlerPagOlak
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Namele : moyens de parvenir à la transformation
Nuselek : prise de conscience à laquelle on parvient
ListeDeDernieresPhrasesDuRayonFantastique
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# Quant à Tarrano, on ne le retrouva jamais, et cette mystérieuse disparition ne fit qu'ajouter de l'éclat à l'étonnante légende épique qu'avait été sa vie... Tarrano le Conquérant.
# Vivement déplorée par de nombreux savants, l'autodestruction de la planète Altaïr-4 est au contraire considérée comme un signe de la Providence par l'Eglise et par les Sages.
*Celles dessinées par Forest
** Extrait : "-Par exemple!... s'exclama l'ingénieur." (page 63)
* Moi je voudrais savoir s'il y a des collectionneurs de moulins à café dans les parages, je recherche un moulin en pins doré, spécialisé dans le moulinage de robusta de calibre 3.7 de Cote d'ivoire. J'échange aussi un aller Londres/New-York contre un ancien four micro-ondes 270W. Merci de répondre assez rapidement. Je suis pressé quand même. Ps : New-York ou San Francisco si ça peut aider...
ListeDesPtitsPapiers
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* %%Blue(Laissez parler Les p'tits papiers
ListeDeLivresEnFrancaisSurLeJeuDeGo
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# Bien conduire sa partie de Go (Lim Yoo Jong et Jean-Pierre Lalo)
# "La belote de comptoir" par Yves Remord
** Pardon accordé
µµcréée par ? sabotée le 24 novembre 2004 et laissé en l'état jusqu'au 10 octobre 2009, date à laquelle je la répara !µµ
ListeDuParlerOhos
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* µRien de neuf par ici ?µ µµ(''plus de gros mots pour l'instant, c'est déjà ça)''µµ
** µ[Par ailleurs, notant qu’il était impossible à ce stade d’obtenir un consensus sur la teneur en histamine en tant qu’indicateur de qualité pour les chinchards salés séchés, le Comité a décidé d’ajourner l’examen du projet de norme à cette session.|http://www.fao.org/docrep/meeting/005/x7603f/x7603f08.htm]µ µ(A noter que la délégation thaïlandaise a attiré l’attention du Comité sur le fait que les normes en cours d’élaboration ne contiennent pas de section sur la %%Green(décomposition)%% %%Smiley(sick)%% et que l’histamine relativement à la qualité n’est pas un indicateur approprié pour ces produits. Il n’est donc pas pratique d’avoir deux teneurs en histamine dans une norme pour la qualité et pour la salubrité, et cette section devrait être supprimée. Les délégations de l’Indonésie et du Viet Nam se sont ralliées à ce point de vue. - Comme d'habitude, la délégation Birmane prend les positions que l'on sait.)µ
ListeDuParlerUhas
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDesIconesDeMonBureau
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(Parce ce qu'on a tous le droit d'avoir un bureau en bordel)%%
* South Park Rally
ListeDeJargonsProfessionnels
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Ne jamais dire jamais. JPR bientôt au Sénat et peut-être futur président par intérim ? -- Raté !
* le verlan, ou jargon des djeuns µ(encore pas trop dur à décoder pour Echelon ou Carnivore)µ ''voir ListeDuSavoirParlerJeune, ListePourParlerJeune et ListeDesExpressionsaLaMode''
** µ Peut-on signaler, pour l'édification générale des wikistes, que le verlan est une pratique de cryptage déjà ancienne qu'on retrouve déjà par exemple sous la plume de Cyrano de Bergerac ?µ
*** µBien expliqué&nbsp;? Un article qui liste les interfaces homme-machine, en citant tous les parfums de Windows sans citer une seule fois X-Window et ses dérivés, peut-il être crédible&nbsp;?µ
/* arrêtez de mettre des nbsp;partout ! pour un seul espace, c'est pas utile !
« - Docteur, je n'arrive plus à faire les travaux domestiques que je faisais auparavant.
- Parfait, nous allons vérifier ça. »
- Parfait, alors dans un jargon compréhensible, vous êtes seulement paresseux.
* [Et si le jargon scientifique servait parfois à dissimuler le vide des idées|http://www2.unil.ch/spul/allez_savoir/as11/4busino.html] ? Plus largement, le jargon a-t-il le pouvoir de rendre vrai le faux ?
ListedeClassifications
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**a) appartenant à l'Empereur,
* ListedesNombresEntiersNaturelsClassesParOrdreAlphabetique
**Les « moi jamais, mais il ne faut jamais jurer de rien » (celles qui disent parfois oui )
** Ceux qui subsistent avec 50 dollars par jour (ou davantage)
****** Habitants du Canton / Département / Etat
************** Habitants de l'Appartement
**************** Simon Gallubert (par exemple)
*************** Partie du Corps de l'Habitant
************* Partie de l'Organe de l'Habitant
** Le besoin d'appartenance - µavoir le sentiment de faire partie d'un groupe de plein droit (une sorte de développement du besoin de sécurité)µ
** Classificatrice - µcelle qui permet de faire des listes (par exemple celle-ci)µ
*** Parabole
*** Paraboloïde hyperbolique
*** Paraboloïde elliptique
** Par nombre de faces
** Par forme des faces
** Par nombre d'arètes
** Par nombre de sommets
** Par planète associée ''(c'est quoi cette fantaisie ? - C'est grec.)''
**Dans les années 50, la marque Empreinte invente en France 3 profondeurs de bonnets A, B et C. Le D naîtra en 1960 et le E en 1962. Les autres marques adopteront ce système progressivement… Auparavant la profondeur du bonnet était simplement proportionnelle à la mensuration
* La typologie tripartite des films de [Russ Meyer|http://www.talkingblue.com/directors/russ_meyer.htm] (1922-2004)
* Une classification des méthodes de classification µ(esquisse parfaitement discutable)µ
********x££1££ paquets de feuilles agrafées par paquet de y££1££
********x££2££ paquets de feuilles agrafées par paquet de y££2££
********x££n££ paquets de feuilles agrafées par paquet de y££n££
*******des paragraphes
Liste déposée par S., le 11 novembre 2003 - 'tain, déjà !
* ListeDeSynonymesDuDesordreClassesParOrdreAlphabetique
ListeDeLaBonneEpouse
/*Par pitié n'attachez pas votre bonne épouse avec des liens trop gros. merci
*Cette liste µ(on trouve ça un peu partout sur le net)µ faisait prétendument partie d'un manuel scolaire d'économie domestique anglo-saxon, publié en 1960. C'est en fait une adaptation d'un texte anglais paru en 1955 et que vous pouvez agrandir
* Préparez les choses à l'avance, le soir précédent s'il le faut, afin qu'un délicieux repas l'attende à son retour du travail.
*C'est une façon de lui faire savoir que vous avez pensé à lui et vous souciez de ses besoins. La plupart des hommes ont faim lorsqu'ils rentrent à la maison et la perspective d'un bon repas (particulièrement leur plat favori) fait partie de la nécessaire chaleur d'un accueil.
**Il vous faudra préparer et allumer un feu dans la cheminée, auprès duquel il puisse se détendre.
**Il se peut que vous ayez une douzaine de choses importantes à lui dire, mais son arrivée à la maison n'est pas le moment opportun. Laissez-le parler d'abord, souvenez-vous que ses sujets de conversation sont plus importants que les vôtres. Faites en sorte que la soirée lui appartienne.
**Ne vous plaignez pas s'il est en retard à la maison pour le dîner ou même s'il reste dehors toute la nuit. Considérez cela comme mineur comparé à ce qu'il a pu endurer pendant la journée. Installez-le confortablement. Proposez-lui de se détendre dans une chaise confortable ou d'aller s'étendre dans la chambre à coucher. Préparez-lui une boisson fraîche ou chaude. Arrangez l'oreiller et proposez-lui d'enlever ses chaussures. Parlez d'une voix douce, apaisante et plaisante. Ne lui posez pas de questions sur ce qu'il a fait et ne remettez jamais en cause son jugement ou son intégrité. Souvenez-vous qu'il est le maître du foyer et qu'en tant que tel, il exercera toujours sa volonté avec justice et honnêteté.
**Débarrassez la table rapidement et faites la vaisselle. Si votre mari se propose de vous aider, déclinez son offre car il risquerait de se sentir obligé de la répéter par la suite et après une longue journée de labeur, il n'a nul besoin de travail supplémentaire. Encouragez votre mari à se livrer à ses passe-temps favoris et à se consacrer à ses centres d'intérêt et montrez-vous intéressée sans toutefois donner l'impression d'empiéter sur son domaine.
**Si vous avez des petits passe-temps vous-même, faites en sorte de ne pas l'ennuyer en lui parlant, car les centres d'intérêts des femmes [http://www.french-spirit.com/htdocs/html/fr/news/images/broderie.jpg] sont souvent assez insignifiants comparés à ceux des hommes.
*afin qu'elle soit prête pour le lendemain matin et pensez à préparer son petit déjeuner à l'avance. Le petit déjeuner de votre mari est essentiel s'il doit faire face au monde extérieur de manière positive. Une fois que vous vous êtes tous les deux retirés dans la chambre à coucher, préparez-vous à vous mettre au lit aussi promptement que possible. [http://pagesperso-orange.fr/lemomo2/zaza.gif]
*Bien que l'hygiène féminine soit d'une grande importance, votre mari fatigué ne saurait faire la queue devant la salle de bains, comme il aurait à la faire pour prendre son train. Cependant, assurez-vous d'être à votre meilleur avantage en allant vous coucher. Essayez d'avoir une apparence qui soit avenante sans être aguicheuse. Si vous devez vous appliquer de la crème pour le visage ou mettre des bigoudis, attendez son sommeil, car cela pourrait le choquer de s'endormir sur un tel spectacle.
**Il est important de vous rappeler vos vœux de mariage et en particulier votre obligation de lui obéir. S'il estime qu'il a besoin de dormir immédiatement, qu'il en soit ainsi. En toute chose, soyez guidée par les désirs de votre mari et ne faites en aucune façon pression sur lui pour provoquer ou stimuler une relation intime.
**Acceptez alors avec humilité tout en gardant à l'esprit que le plaisir d'un homme est plus important que celui d'une femme, lorsqu'il atteint l'orgasme, un petit gémissement de votre part l'encouragera et sera tout à fait suffisant pour indiquer toute forme de plaisir que vous ayez pu avoir.
[http://www.bdparadisio.com/images/calbut2.jpg]
*%%Blue(Quelle horreur!!! A les entendre on croirait que la femme doit vivre pour l'homme!! D'ailleurs c'est ce qu'ils insinuent... Et avec toutes ces contraintes, ils parlent encore de sincérité (Accueillez-le avec un chaleureux sourire et montrez de la sincérité dans votre désir de lui plaire.)!! Et vous vous rendez compte, ils essaient de nous dicter notre conduite JUSQUE DANS LE SEXE!!! Quelle horreur!! C'est de l'esclavagisme, notre corps ne vous appartient pas (comme dit Le Pen...). berk berk berk berk ça me donne envie de vomir!)%%
*%%Green(Si vous vomissez, veillez à ce que tout soit nettoyé avant qu'il ne rentre, pensez aussi à désodoriser l'appartement et à jeter les serpillières souillées. Vous ne lui ferez bien sûr, aucune allusion. Il a ses propres soucis et lui parler de choses aussi triviales serait une faute de goût...)%%
µListe lancée par Sergio le 12/11/2003, sur une idée du [psikopat|http://www.psikopat.com/]µ -- E X C E L L E N T ! ! ! -- µµ(Ah ces mecs, il leur en faut peu... - C'est pas un peu beauf, cette liste ..?) - Meuu non !µµ -%%Blue(%%Big(Carrément, oui!)%%)%%- µµpsst pssst faut pas crier comme ça ma p'tite dame, et il faut aussi arrêter de tout prendre au 1er degré... :-)µµ
ListeDePapes
/*Par pitié, ne mettez pas de liens vers de Grosses Images trop lourdes ou trop longues à charger (et qui n'apportent pas grand chose à cette liste). Merci !
µµd.n.i. = date de naissance inconnue - d.d.i. = date de décès inconnue - (si la date de décès n'est pas indiquée c'est qu'elle correspond à la fin de règne) - En cas de doubles parenthèses, les premières indiquent les dates de vie, les secondes les dates de règne.µµ
%%Center(Le terme de Pape n'apparaîtra qu'en 306 : le début de cette liste est apocryphe, (attribué à Saint Irénée au IIe siècle, mais en fait rédigée par Eusèbe de Césarée, dit Eusèbe le menteur au IVe siècle) aucun historien sérieux n'a jamais pu prouver l'existence de ces personnages - y compris celle de Saint Pierre)%%
* __Pierre 1er (saint Pierre)__ : (d.n.i.) (30 - 64? ou 67?) (Galiléen ? serait mort martyr, crucifié la tête en bas) (Il y a à Rome 2 crânes de saint Pierre, l'un hors les murs - qui est d'ailleurs un crâne féminin - et un autre au Vatican...) - On peut voir au musée de la basilique St Pierre une copie :-) du trône en lames de bois de St Pierre... Amusant parce que même en supposant que le personnage ait existé, il n'était jamais que le chef d'une communauté de quelques dizaines de croyants clandestins, alors à quoi bon un trône ? Quant aux fouilles entreprises à partir de 1939 sous l'actuelle basilique St-Pierre, afin de retrouver son tombeau, les résultats (validés par le Vatican) laissent perplexes !
%%Center(''en sachant qu'il y peut aussi y avoir dans cette partie de la liste des personnages non validés historiquement...'')%%
* __Zéphyrin__ : (d.n.i.) (199-217 romain ? martyr ?) ''µ(c'est joli comme nom de pape, ça Zéphyrin, non ?)µ''. "Faible", manipulé par Calixte qui lui succédera et critiqué par Hippolyte qui deviendra le 1er anti-pape
**µ''les antipapes sont principalement des papes élus par des groupes de pression opposés au résultat de l'élection "officielle". Il s'agit donc de papes "scissionnistes"''µ
**''en 230 la messe à Rome est désormais célébré en latin, auparavant elle était dite en grec...''
!%%Center(Apparition du titre de Pape)%%
* __Miltiade (ou Melchiade)__ : (311-314) Originaire d'Afrique du Nord. S'installe au palais de Latran en 312, demeure offerte par l'empereur Constantin.
* __Sylvestre 1er__ : (314-335) : En 321, l'empereur Constantin décrete que le dimanche devient le jour de repos officiel du monde romain. En 325, Concile de Nicée convoqué par l'empereur Constantin : après une ordination, un prêtre ne peut plus se marier. Le Credo de Nicée est proclamé. Fixe le calcul de la date de Pâques et proclame la consubstantialité du Père et fils (voir en bas) Ce pape mourut le 31 décembre 335, canonisé par la suite, ce jour devint donc la Saint-Sylvestre. C'est sous l'impulsion de ce pape que commencèrent les travaux de la première Basilique St Pierre, au dessus du tombeau présumé de Saint-Pierre.
** ''en 367, l'évêque Athanase d'Alexandrie dresse la liste des titres destinés à former le Nouveau Testament parmi les __70__ (environ) [évangiles|ListedEvangiles] existants !''
**''en 405, St Augustin écrit : " Rien n'est plus puissant pour tirer l'esprit d'un homme vers le bas que les caresses d'une femme". Parlait-il à partir de sa propre expérience ? ''
* __Eulalius__ : (418-419) antipape, remplacé par Boniface 1er
* __Jean 1er__ : (523-526) : emprisonné par l'empereur Théodoric (le pape avait échoué dans une tentative de médiation entre les Wisigoths et Byzance)
* __Silvère__ : (536-537) (†538) marié, fils du pape Hormisdas. Viré par l'impératrice Théodora qui le fait exiler sur l’île déserte de Palmarola où il mourra de faim 7 mois plus tard.
* __Vigile__ : (537-555) Désigné comme successeur par Boniface II, il sera écarté à la mort d'Agapet par Silvère. Nommé pape après l'éviction de ce dernier grâce à l'influence de l'impératrice Théodora dont il fut l'amant. Se brouille avec l'empereur Justinien pour des raisons théologiques et reste 10 ans prisonnier de à Constantinople. Enfin libéré et autorisé à regagner Rome il décédera en route.[http://pagesperso-orange.fr/lemomo2/Pape_Vigile.jpg]
* __Honoré 1er (Honorius)__ : (625-638) Condamné comme hérétique par le Concile de Constantinople en... 681 !
* __Martin 1er__ : (649-653) : Emprisonné en 653 par l'empereur de Byzance, condamné à mort, dégradé publiquement, et finalement déporté à Cherson (Sébastopol), où il mourut de misère (656).
* __Sisinnius__ : (janv-fev 708) malade de la goutte, il est le type même du pape qu'on élit par défaut, afin de se donner quelques jours de plus pour trouver le bon. Celui-ci au moment de son élection ne pouvait déjà plus se servir ni de ses mains, ni de ses pieds et décéda 20 jours plus tard.
* __Grégoire III__ : (731-741) : A l'occasion des funérailles de Grégoire II en 731, la foule s'empara d'un prêtre d'origine syrienne dans la procession et le nomme pape. Devenu Grégoire III, il régnera dix ans. Menacé par le roi des lombards, il appelle Charles Martel au secours... qui refuse. Condamna formellement la consommation de viande de cheval pratique considérée comme "abominable" !
* __Zacharie__ : (741-752) Moine bénédictin et dernier pape grec. Complote avec les francs afin d'officialiser Pépin le Bref comme roi de France, mettant fin à la dynastie des mérovingiens. Confirme formellement l'interdiction de consommer du cheval édictée par son prédécesseur.
* __Étienne__ : (mars 752) Ce prêtre fut élu pape à la mort de Zacharie, mais mourut d'apoplexie trois jours après, avant d'avoir été intronisé. A disparu en 1961 de la liste officielle des papes, mais certains ouvrages historiques le nomme Etienne II ce qui décale donc tous les numéros des Etienne...
* __Étienne II__ : (752-757) célèbre farceur, convoqua Pépin-le-Bref pour lui donner une lettre que saint Pierre venait juste de descendre du ciel... et suite à cela, création officielle des Etats Pontificaux (à l'époque la moitié de la péninsule italienne) suite à la reconnaissance de ceux-ci par Pépin. en 754. Etienne II s'appuie pour obtenir ces territoires sur un document (La donation de Constantin) que l'empereur Constantin aurait remis en 335 au pape Sylvestre 1er et qui établirait l'autorité spirituelle et temporelle de la papauté. Un faux grossier qui sera dévoilé comme tel en 1440.
* __Constantin II __ : (768) antipape - élu par l'aristocratie à la mort de Paul 1er, renversé par les lombards qui lui crevèrent les yeux.
* __Philippe__ : (768) antipape imposé par les Lombards. Démissionne le lendemain de sa nomination !
* __Étienne III__ : (768-772) : Concile de Rome (Latran) en 769, les laïcs n'ont plus le droit de participer à l'élection du pape (en théorie). Envoie une lettre à Charlemagne dans laquelle il lui parle de sa future épouse, Désirée de Lombardie qu'il lui décrit comme "hideuse, puante et lépreuse..." (il était contre ce mariage)
* __Léon III__ : (795-816) :En 1799, les neveux de son prédécesseur lui tendent une embuscade, le passe à tabac, et le font enfermer dans un monastère. On l'accuse de parjure, d'avoir des penchants pour les religieuses, d'être bisexuel et d'avoir fait assassiner son amant Bartolomeo d'Amalfi. Il s'échappe, se réfugie auprès de Charlemagne et le sacre en l'an 800 après avoir juré ses grand dieux que tout ce qu'on lui reprochait n'était que des vilains mensonges.
* __Étienne IV__ : (816-817) : réinstallé dans ses fonctions par Charlemagne après avoir été chassé de Rome
* __Jean VIII__ : (deuxième du nom) (872-882) Excommunie à tout va, se fait un tas d'ennemis, fuit un moment en France. Empoisonné par sa famille, le poison n'agissant pas assez vite, il est achevé à coups de marteau.
* __Adrien III__ : (884-885) : Commence sa carrière en faisant crever les yeux de l'un des assassins de Jean VIII. Cet acte de "charité" n'empêcha pas Léon XIII de le béatifier en 1891 (1000 ans plus tard). A la mort d'Adrien III, vraisemblablement assassiné, les moines de l'abbaye de Modène disparurent avec ses objets de valeurs, tandis que les foules pillaient sa basilique du Latran
** ''les successeurs de ce pape réhabilitent Formose, récupère le cadavre qui avait été repêché par des pêcheurs et le rapporte dans la Basilique St-Pierre d’où il ne bougera plus. Le concile décide qu’il sera désormais interdit d’intenter des procès contre les morts et de brutaliser les évêques au cours des assemblées''
* __Léon V__ : (juil-dec 903) élu pour trois mois !... emprisonné puis étranglé par l'antipape Christophore (qui sera lui-même arrêté et exécuté sur l'ordre de Serge III)
* __Léon VII__ : (936-939) nommé et contrôlé par Albéric II
* __Étienne VIII (ou IX)__ : (939-942) nommé et contrôlé par Albéric II, il lui prend l'envie de se débarrasser de cet encombrant protecteur. Ce fut un échec, Etienne IX eut le nez coupé et mourra de ses blessures.
* __Marin II__ : (ou Martin III) (942-946) troisième pape nommé et contrôlé par Albéric II
* __Agapet II (ou Agapit__): (946-955) quatrième pape nommé et contrôlé par Albéric II, lequel Albéric mourant fait jurer Agapet de choisir comme successeur son propre fils Octavien !
* __Jean XII__ : (955-963) Octavien, comte de Tusculum, change de nom pour ne pas porter le prénom d'un empereur païen, fils incestueux d'Albéric II et de Marozia, pape à 18 ans (ou 17 ou 16 selon certaines sources), bisexuel il fit du Latran une "sorte de lupanar". Déposé en 963 par Othon, celui-là même qu'il avait sacré empereur deux ans plus tôt, il est remplacé par Léon VIII, mais les romains n'appréciant pas ce dernier le font déposer et rappelle Jean XII qui mourra en 964 à 27 ans battu à mort par un mari jaloux !
* __Léon VIII__ : (963-964) antipape nommé par l'empereur Othon, déposé en 965
* __Jean XIII__ : (965-972) exilé pendant un mois, il finit par revenir à Rome
* __Grégoire V__ : né en 973 (996-999) Nommé pape par son cousin l'empereur Othon III. De son vrai nom, Bruno de Carinthie et premier pape germanique (à 23 ans), il préféra changer de prénom. Meurt empoisonné (ou de la malaria, ça dépend des historiens)
* __Jean XVI__ : (996-998) antipape (contre Grégoire V) on lui arracha les yeux et la langue et on lui coupa le nez et les oreilles... il survécut parait-il à tout cela (?) jusqu'en 1013 dans une abbaye.,
** Ce moine était un érudit, il s'intéressait à tout, et quand on dit à tout c'est à tout (géographie, astronomie, mathématiques, médecine) qui étaient des sciences peu pratiquées en Occident à cette époque. C'est à cause de son érudition qu'il sera accusé d'activités sulfureuses ou de diablerie (un moine savant à Cluny, ça faisait fouillis) Mais il tisse aussi des relations (le pape Jean XIII, l'empereur Othon 1er et Hugues Capet, rien que ça !) C'est ce dernier qui le fera nommer évêque. Peu passionné par la charge Gerbert se met à bricoler des orgues, des engins hydrauliques, des globes célestes et des automates. Les romains qui détestaient ce pape français rebondirent sur sa réputation de "faiseur de diablerie" et tentèrent de ternir sa réputation en le faisant passer pour alchimiste, voir sorcier, en prétendant qu'ivre de savoir il aurait vendu son âme au diable en Espagne et que la preuve de sa diablerie serait dans les 3 R de ses archevêchés successifs (Reims, Ravenne et Rome)
** µµun peu timbré (par la poste française) :µµ[http://www.encyclopedie-universelle.com/images/gerbert-pape-sylvestreII-timbre.jpg]
* __Benoît IX__ : (1032-1044, avr-mai 1045, 1047-1048), pape à 12, 15 ou 16 ans ''(ça dépend des biographes)'' ! Récupéra le siège papal deux fois, abdiqua trois fois (dont la seconde fois (1045) pour se marier après avoir "vendu" le Saint-Siège à son parrain Grégoire VI. Manque de chance sa promise changea d'avis) Organisait des "orgies homosexuelles" dans ses palais[http://www.archelaos.com/popes/imgs/Benedict_IX_2.jpg]
* __Clément II__ : (1046-1047) empoisonné (peut-être par Benoît IX qui reprend sa place jusqu'en 1048)
** dans la lettre "Ad splendidum nitentis", adressée par Léon IX à Pierre Damien en 1054, il évoque la réprobation encourue par "ceux qui font jaillir la semence, soit par leurs propres mains, soit entre eux, ou qui l’ont répandue entre les cuisses" (qui vel propriis manibus vel invicem inter se egerunt semen, vel etiam inter femora profuderunt).
%%Center(''Le 14 juillet 1054, le pape Léon IX est excommunié par Michel Cerularius patriarche de Constantinople qui est lui-même excommunié par le légat du Pape. La chrétienté se scinde entre catholiques et orthodoxes. La crise couvait depuis de nombreuses années. Parmi le reproches que les orthodoxes firent à l'église de Rome, certains font sourire : par exemple, utiliser du pain sans levain pour l'Eucharistie, ou se raser la barbe...'')%%
* __Benoît X__ : (1058) antipape, intronisé de force, déposé par Pierre Damien et Gérard de Bourgogne qui prend sa place sous le nom de Nicolas II suite à une élection arrangée.
* __Honoré II__ : (d.n.i.-1071)(1061-1064) antipape contre Alexandre II. Il prit Rome en 1062. Déposé par Alexandre II, il restera néanmoins évêque de Parme jusqu'à sa mort.
* __Grégoire VII__ : (né vers 1015-1020)(1073-1085) oblige les prêtres au célibat. ("Les prêtres doivent tout d'abord s'échapper des griffes de leurs femmes") En 1076, la diète de Worms déposa Grégoire comme ''"hérétique, magicien, adultère, flatteur de la populace, usurpateur de l'Empire, bête féroce et sanguinaire"'' rien que ça ! on lui cherche un successeur. Le pape répond en excommuniant tous les évêques qui avaient assisté à la diète de Worms, en excommuniant et en déposant l'empereur, et en défendant à ses sujets de lui obéir. Les évêques retournent alors leur veste et implore le pardon du pape. Promulgue le ''didactus papae'' encore en vigueur aujourd'hui :
**Seule l'Église romaine est fondée par Dieu
**Il ne peut être jugé par personne
%%Center(µµ représenté parfois (à tort ?) avec une barbe µµ)%%
* __Jean__ : (1100) : Antipape non reconnu comme tel par l'église ! Lors de la procession qui suivit l'élection du pape, on s'aperçut qu'il s'agissait d'une femme et qu'elle était enceinte ! La papesse Jeanne fut traînée hors de Rome et lapidée. (µSource : "Encyclopædia Universalis".µ) L'histoire niée par l'église moderne fut néanmoins reconnue par le concile de Latran et citée par diverses sources religieuses. Certains situent cet épisode à une date différente (855, 885, 1087) à moins qu'il y ait eu deux papesses ? µµvoir aussi en bas de pageµµ
* __Theodoric__ : (d.n.i.-1102)(1100-1101) antipape élu à la mort de Clément III, capturé par les troupes de Pascal II et enfermé à vie dans un monastère
* __Sylvestre IV__ : (né v.1050, d.d.i)(1105) antipape nommé par l'empereur Henri V pour s'opposer à Pascal II, mais se soumet à ce dernier
* __Gélase II__ : né v.1058, (1118-1119) emprisonné le lendemain de son élection, libéré par la foule, poursuivi par les troupes de l'empereur Henri V qui veulent installer Grégoire VIII à sa place, cherche protection en France auprès du roi Louis VI le gros et meurt d'épuisement à l'abbaye de Cluny.
* __Grégoire VIII__ : (d.n.i.-d.d.i.)((1118-1121) antipape. Arrêté par les troupes de Calixte II, on trouva malin de le promener dans toute la ville assis à l'envers sur un chameau afin de l'humilier. Il sera ensuite enfermé jusqu'à sa mort.
* __Célestin II__ : (d.n.i.-d.d.i.) Élu régulièrement en 1124, (mais écarté de la liste officielle des papes) il est attaqué le lendemain de son élection par des hommes de main à la solde de son rival. Blessé, il abdique, et est aussitôt remplacé par Honorius II
* __Innocent II__ : (d.n.i)((1130-1143) Saint-Bernard de Clervaux prend position pour Innocent II et contre Anaclet II, parce que ce dernier est d'origine juive et qu'il considère comme une injure que la "race" juive puisse occuper le siège de saint Pierre. Innocent II convoque un concile à Clermont en 1130 afin d'interdire aux chevaliers de se battre en tournoi.
* __Anaclet II__ : (d.n.i)(1130-1138) antipape contre Innocent II. Excommunié par le concile de Pise en 1134.
* __Lucius III__ : (d.n.i.)(1181-1185) Moine jugée indésirable par les romains (il n'habitera jamais Rome). Avec l'accord de Fréderic Barberousse, il décrète que le pouvoir religieux pourra se faire aider du pouvoir politique pour lutter contre les hérésies. C'est l'institution du fonctionnement de l'inquisition : L'autorité civile arrête les présumés coupables, l'autorité religieuse interroge et juge... et l'autorité civile exécute le jugement, ce qui permet à l'Eglise de garder les "mains propres".
**1215 Concile de Latran (Latran IV) : Première apparition de la charge de "curé" affecté à une paroisse (du latin "cura animarum"). Le mariage religieux avec publication des bans devient obligatoire. Impose aux juifs et aux musulmans le port d'un insigne distinctif. Condamne les Vaudois et les Albigeois (Cathares)
* __Grégoire IX__ : né en 1170, (1227-1241). Excommunie l'empereur Frédéric II pour l'obliger à partir en croisade. Création officielle de l'Inquisition (1231). Condamne le Talmud comme étant "rempli de toutes sortes de vilainies et de blasphèmes contre la doctrine Chrétienne."
* __Jean XXI__ : né en 1220, et unique pape portugais (1276-1277) ophtalmo avant d'être pape. Tué par la chute d'un plafond. Pourquoi Jean XXI alors qu'il n'y a jamais eu de Jean XX ? Mystère ''(Ces gens là ne savent pas compter !'')
* __Célestin V__ : né en 1209, (juill-dec 1294) élu plus ou moins contre sa volonté, abdique après 6 mois, conscient qu'il n'est pas fait pour le poste, se retirera dans un ermitage où il mourût en 1296 (officiellement d'une infection suite à un abcès, mais sans doute très aidé par son successeur)
* __Boniface VIII__ : né en 1235, (1294-1303) : Prétend que son sacerdoce spirituel lui donne autorité sur les princes de ce monde. ''(Bulle unam sanctam, 1301)'' Du coup Philippe le Bel, le fait prisonnier (afin de le faire accuser d'hérésie) le 8 septembre 1303 à Anagni (près de Rome), le pape est passé à tabac (giflé avec un gantelet de fer), libéré le lendemain par la population, il regagne Rome et meurt un mois plus tard.
* __Clément V__ : (Bertrand de Got) né vers 1264 en Gascogne (1305-1314). Archevêque de Bordeaux et propriétaire viticole. Il fallut un an de discussion pour désigner ce pape. Il transfère le siège papal en Avignon en 1309. Fit preuve d'un soutien quasi inconditionnel au roi de France, Philippe de Bel. Convoque un concile à Vienne (France) uniquement pour mettre les Templiers hors la loi, leurs confisquer leur immenses richesses et les condamner à être brûlés vifs. µOn dit que le grand maître, Jacques de Molay, maudit le pape et le roi de son bûcher à l'extrémité de l'ile de la Cité (où se trouve aujourd'hui le Pont Neuf) à Paris : ni l'un ni l'autre ne passèrent l'année.µ
* __Benoît XII__: né en 1285, (1334-1342) Evêque et inquisiteur de Pamiers dans son Ariège natal ou il se fait remarquer par sa cruauté.
* __Urbain V__ : né en 1309 dans le Languedoc, (1362-1370). Il était avant d'être élu simple prêtre à Marseille et n'a pas participé au conclave. Premier pape barbu.
* __Grégoire XI__ : né en 1331, (1370-1378) Cardinal à 17 ans, pape à 39 ans. (élu au 1er tour à l'unanimité). Ce neveu de Clément VI déménage sous la contrainte la papauté d'Avignon à Rome. Originaire du Limousin (lui aussi) et dernier pape français, il aimait tellement sa province natale qu'avant de mourir il nomma cardinaux huit limousins dont cinq de ses parents. L'inquisition bât son plein. A Florence, Venise et à Rome les bûchers fonctionnent en continu.
* __Alexandre V__ (Pise) : né en 1340, (1409-1410) élu par le concile de Pise, probablement empoisonné par son successeur
* __Jean XXIII__ (Pise) : (né v. 1360, † 1419) (1410-1415) antipape (fait emprisonner Alexandre V pour occuper la fonction à sa place) déposé par le concile de Constance (qu'il avait convoqué) comme "forban et sodomite" d'autres disent qu'il aurait démissionné... Prisonnier trois ans en Bavière, il rachète sa liberté et fait allégeance à Martin V qui le nomme cardinal, mais meurt (empoisonné ?) peu de temps après. ''(il y a donc eu 2 Jean XXIII)''
* __Benoît XIV__ (?-?) (Avignon) antipape en 1425 (contre Clément VIII), puis disparaît de la circulation.
*µµUne certaine littérature avance que l'antipape Benoît XIV aurait nommé des cardinaux qui auraient continué la lignée d'Avignon. On parle ainsi d'un Benoît XV (1437-1470), d'un Benoît XVI (1470-1499) et d'autres à leur suite, tout cela sans source historique fiable.µµ
* __Eugène IV__ : né en 1383, (1431-1447) Auteur en 1442 de la bulle "Cantate Domino" qui dit : "La sainte Eglise romaine croit fermement, professe et prêche qu’aucun de ceux qui vivent en dehors de l’Eglise, non seulement les païens, mais aussi les juifs ou les hérétiques et les schismatiques, ne peut avoir part à la vie éternelle, mais qu’ils iront au feu éternel "préparé pour le diable et ses anges" (Mt 25, 41), sauf si, avant la fin de leur vie, ils sont réunis à l’Eglise." Oncle de Paul II qu'il nommera cardinal à 23 ans.
* __Félix V__ : (1383-1451) (1439-1449) duc Amédée VIII de Savoie - le dernier des antipapes historiques, (à Bâle !) fut marié à Marie de Bourgogne dont il eut 9 enfants. On lui prête sa participation à des "orgies homosexuelles"
* __Calixte III__ (Alphonse Borgia) : né en 1378, (1445-1458) Oncle du futur Alexandre VI (Rodrigo Borgia). Signe une bulle autorisant le Portugal à asservir les autochtones d'Angola (qui seront ensuite envoyés comme esclaves au Brésil). On lit parfois qu'il aurait excommunié... la grande comète de Haley en 1456, c'est faux, on ne peut excommunier que ce qui est baptisé ! En revanche il a demandé aux fidèles de prier afin de l’exorciser (ce qui est au moins aussi ridicule)
* __Paul II__ : (Pietro Barbo) né en 1417, (1464-1471) Nommé cardinal à 23 ans par son oncle, le pape Eugène IV, élu pape "par surprise". Autoritaire, fêtard et ouvertement homosexuel. Mort en se faisant sodomiser par un jeune page (ou vice-versa). La version officielle parle d'indigestion de melons, on a ensuite suggéré qu'ils aient pu être empoisonnés. On parle aussi de mort par apoplexie (aujourd'hui on dit AVC) mais sans toujours préciser s'il était seul et ce qu'il faisait. Il est à l'origine de la couleur pourpre de l'habit des cardinaux.
* __Sixte IV__ : né en 1414 (1471-1484) Proxénète (les prostituées romaines lui versaient annuellement 20.000 ducats) Sixte IV nomme cardinal de nombreux jeunes gens, célèbres par leur beauté, parmi lesquels son neveu et amant Raphaël Riario - cardinal à 17 ans. Au XVIe sicle, le théologien Balaeus révéla que Sixte IV aurait donné aux cardinaux "l'autorisation de pratiquer la sodomie pendant les périodes de grandes chaleurs". Nomma l'infâme Torquemada Grand Inquisiteur en Espagne.(10.200 personnes brûlées vives) Sinon, il subventionne de nombreux artistes parmi lesquels Botticelli et la Chapelle Sixtine qu'il fit restaurer entre 1477 et 1480 lui doit son nom.
* __Alexandre VI__ (Rodrigo Borgia) : né en 1435, (1492-1503) Neveu de Calixte III, évêque à 24 ans sans avoir jamais été prêtre et cardinal à 35 ans. Père de cinq enfants, dont César Borgia. Bisexuel. Le jour même où il a été consacré pape, il nommait son fils, César, archevêque, et ensuite cardinal. Aurait eu des rapports incestueux avec sa fille, Lucrèce Borgia. Auteur d'une bulle qui partage officiellement l'Amérique du Sud entre espagnols et portugais. Assassin sans scrupule, c'est l'un des rares papes dont l'église à honte. Mourut empoisonné (par erreur ?) avec un breuvage destiné à ses "invités". [http://marjorie-art.voila.net/Biog/Alex6.jpg]
* __Pie III__ : né en 1439, (sept-oct 1503) Neveu de Pie II. Refusa plusieurs fois le poste se trouvant trop vieux. Il finit par accepter en 1503 mais ne régna que 26 jours (probablement empoisonné).
* __Jules II__ : (Giuliano della Rovere) né en 1443, (1503-1513) 3 filles illégitimes - fait du Vatican, la première puissance de la péninsule italienne - Réduisit à néant le clan de Borgia. Caractériel, frappa un jour Michel-Ange à coup de bâton, parce que ce dernier ne peignait pas le plafond de la chapelle Sixtine assez vite... Du coup Michel-Ange partit faire ses valises, mais le pape lui envoya un émissaire avec 5000 ducats pour se faire pardonner. Le peintre se remit donc au travail pour se faire à nouveau engueuler le lendemain... Autoritaire, belliqueux, intrigant, il est aussi célèbre pour avoir fondé en 1506 la garde suisse qui à l'époque était une véritable armée. En 1510, le pape Jules II fit construire un bordel strictement réservé aux chrétiens. Fut le dernier pape barbu. Mourut d'une mauvaise fièvre à 70 ans.
* __Léon X__ : né en 1475, (1513-1521) : (Jean de Médicis) Protonotaire apostolique à l'âge de 8 ans, cardinal à quatorze ans, pape à trente-huit ans, autorisa la traite des noirs (affirmant sans rire qu'il s'agissait là d'une "œuvre évangélisatrice" - excommunia Luther qui avait dénoncé la pratiques des indulgences (1521) - ouvertement homosexuel, il célébra son couronnement en privé avec son amant et par la suite le fit cardinal. Ce dernier tentera de l'assassiner en demandant à son médecin chargé de soigner les hémorroïdes du pape, de lui mettre du poison dans l'anus. Le courrier fut intercepté, le médecin écartelé, l'amant put fuir mais fut retrouvé, torturé puis tué par la suite. Il fit aussi dans le mécénat encourageant notamment Michel-Ange et Raphaël, mais ôta sa protection à Pierre l'Arétin considéré comme blasphémateur. Fit aussi en 1520 cette étrange déclaration "''On sait de temps immémorial combien cette fable de Jésus-Christ a été profitable à nous et à nos proches.''" µ(Quantum nobis nostrisque ea de Christo fabula profuerit, satis est omnibus seculis notum)µ - Les caisses du Vatican étant vides, Léon X se montrera astucieux : il eut la brillante idée de créer 30 nouveaux postes de cardinaux et de les vendre à fort prix pour remplir ses coffres... Meurt de la malaria.
*** µArt.5) Aux prêtres est permis de vivre en concubinage avec les propres parents derrière le paiement de 76 livres.µ
** ''Concile de Trente en 1542 : convoqué par Paul III il couvrira 5 pontificats (Paul III, Jules III, Marcel II, Paul IV et Pie IV) Il s'agit du concile de la contre-réforme, l'église y réaffirme ses dogmes face à la réforme protestante. L'adultère est désormais considéré comme péché mortel au même titre que le crime.''
* __Jules III__ : né en 1487, (1550-1555). Elu après deux mois de conciliabules. Ouvertement homosexuel, son pontificat est plus marqué par les fêtes, festivals, chasses, courses et autres parties que par la conduite des affaires de l'église. Se fit remarquer en nommant cardinal le domestique qui s'occupait de son singe apprivoisé. Proclame en 1554 la Bulle papale "Contra Hebreos retinentes Libros" ordonnant que le Talmud soit brûlé "partout et en tous lieux."
* __Paul IV__ : né en 1476, (1555-1559) Auteur en 1555 de la bulle "Cum nimis absurdum" qui dit "Il nous paraît absurde et inadmissible d'étendre la charité et la tolérance chrétiennes aux juifs, condamnés par Dieu, à cause de leurs péchés, à la servitude éternelle." Choqué par la vue de sexes apparents sur le plafond de la chapelle Sixtine, il leur fait peindre des voiles afin de les cacher... µµ(cette censure ne sera pas complète et sera finalisée par Clément XIII 200 ans plus tard)µµ. Il est aussi choqué par les œuvres de Pierre l'Arétin qu'il mettre à l'index. A envoyé plusieurs centaines de moines au bagne et obligé les Juifs à porter un uniforme pour qu'on les reconnaisse dans la rue. Cette coquetterie vestimentaire était en quelque sorte l'ancêtre de l'infâme étoile jaune qui, 400 ans plus tard, allait condamner des millions de personnes à la mort, pendant que le gentil pape Pie XII regarderait pieusement ailleurs. A la mort de Paul IV, le peuple romain fait la fête, jette sa statue dans le Tibre et incendie la prison des inquisiteurs.
* __Pie V__ : né en 1504, (1566-1572) Inquiet des conséquences de l'invention de l'imprimerie, le pape crée l'index qui édite régulièrement une liste de livres interdits (l'index perdurera jusqu'en 1961) - Et attention changement de couleur : précédemment les papes portaient une soutane rouge, désormais ce pape, ancien dominicain, (il fut moine à 14 ans) imposera la couleur de son ordre, le blanc ! Il chasse les courtisanes de Rome et oblige les cardinaux à la continence. Il interdit que les prostituées puissent bénéficier d'une sépulture chrétienne. Il encourage la lutte contre les huguenots en France (alors que l'édit de St Germain leur accordait la liberté de culte). Il excommunie Élisabeth 1ère d'Angleterre, ne lui ayant jamais pardonné le fait qu'elle soit la fille d'Ann Boleyn. En 1571, lève une coalition (victorieuse) contre les turcs et institue la fête de Notre-Dame des Victoires pour fêter l'événement. Expulse (1569) tous les Juifs des États papaux. Intolérant jusqu'à la caricature, il sera canonisé par Clément XI. C'est ce pape qui fixa en 1570 (suite aux décisions du concile de Trente) les modalités de la messe dite tridentine££(1)££ , en latin et le cul tourné vers les fidèles.
**µ''Le 29 septembre 1567, environ 80 catholiques sont massacrés au cours d'une émeute par des protestants à Nîmes. (la bêtise n'est pas qu'une spécialité catholique ! Mais ce qui est lamentable c'est que certains catholiques avancent encore aujourd'hui cet événement pour relativiser l'horreur que fut la Saint-Barthélemy.''µ
* __Grégoire XIII__ : (Ugo Boncompagni) né en 1502, (1572-1585) Un fils illégitime - Il a laissé son nom au calendrier dit grégorien, en décidant que le lendemain du 4 octobre 1582 serait le 15 octobre ! Proclame une bulle en 1581 à propos des juifs dans laquelle il déclare : "Mus par une intense haine des membres du Christ, ils continuent à concevoir des crimes horribles contre la religion chrétienne avec une audace qui grandit à chaque jour qui passe." Le premier castrat entre en 1582 dans les effectifs du chœur de la chapelle Sixtine, c'est-à-dire la chapelle privée du pape.
* __Sixte V__ : (Felice Peretti) né en 1520, (1585-1590) - Sixte V (ou Sixte-Quint) ancien cordelier, et ancien inquisiteur à Venise (remarqué pour sa cruauté) assistait joyeusement aux exécutions en se faisant porter à manger car ''"ces actes de justice lui donnaient de l'appétit"''. Après l'exécution d'une sentence il dit : ''" Dieu soit béni pour le grand appétit avec lequel j'ai mangé ".'' Complètement refoulé le début de son règne est une attaque en règle contre l'avortement, la prostitution, l'adultère et la sodomie... Il félicite en public le meurtrier d'Henri III (le moine dominicain Jacques Clément) et envisage de le faire canoniser ! Sixte-Quint, déclara en 1587, par sa lettre du 25 juin à son nonce en Espagne, qu’il fallait démarier tous ceux qui n’avaient pas de testicules. A l'annonce de sa mort, les romains firent la fête et déboulonnèrent sa statue.
* __Urbain VII__ : né en 1521, (1590) Semblait animé de bonnes intentions mais succomba à la malaria 9 jours après son élection. Précurseur du lobby antitabac il menaçait d'excommunication "quiconque prendrait du tabac sur le parvis ou à l'intérieur d'une église, que ce soit en le mâchant, en le fumant avec une pipe ou en l'aspirant sous forme de poudre à travers le nez".
* __Clément VIII__ : (Ippolito Aldobrandini) né en 1536, (1592-1605) Responsable de l'exécution sur le bûcher de Giordano Bruno en 1600 (lequel avait été auparavant excommunié de l'église luthérienne), s'oppose au projet de mariage entre Henri IV et Gabrielle d'Estrées, autorise la consommation du café. Autorise la pratique permettant d'obtenir des castrats afin de créer "des voix angéliques pour honorer la gloire divine."
* __Léon XI__ : né en 1635, (1605) Il s'enrhume en prenant possession de ses appartements, se soigne mal et décède après 27 jours de pontificat.
* __Grégoire XV__ : né en 1554, (1621-1623) Elu par acclamations, il modifiera les modalités du conclave (vote à bulletins secrets).
**L'Église catholique sera très lente à admettre le fait que la Terre tourne bien autour du soleil. Jusqu'en 1757, la Congrégation de l'Index interdira la parution d'ouvrages "traitant du mouvement de la terre". Il nommera tous ses neveux cardinaux. Ce pape interdira l'usage du tabac.(1642) Par contre en 1639, il interdit la mise en esclavage des populations indigènes du Brésil, du Paraguay et des Caraïbes.
**1648 : ''fin de la guerre de 30 ans - Jusqu’à cette date, il y eut 245 papes. Parmi ceux-là, 24 papes étaient des "antipapes". Et selon la vérité historique qui fut longtemps tenue pour fable, il y eut une "papesse". 19 papes ont quitté Rome, 35 ont régné à l’étranger, 8 papes n’ont pas régné plus d’un mois, 40 ont régné un an, 22 jusqu’à 2 ans, 54 jusqu’à 5 ans, 57 jusqu’à 10 ans, 51 jusqu’à 15 ans, 18 jusqu’à 20 ans et seulement 10 papes ont régné plus de 20 ans. Des 245 papes, 31 furent déclarés usurpateurs ou hérétiques. Tandis que parmi les papes légitimes, 64 moururent d’une mort violente, 18 papes furent empoisonnés, 4 furent étranglés et 13 moururent de diverses manières''
* __Innocent XI__ : né en 1611, (1676-1689) en 1686. Deux mille Vaudois massacrés par les catholiques dans les vallées alpines sur ordre direct du Pape, qui à le toupet de se faire appeler "Innocent"
* __Clément XI__ : né en 1649 (1700-1721) C'est sous son règne qu'eu lieu, organisé par Louis XIV, l'épouvantable répression de la révolte des Camisards, (1702-1704) 450 villages furent brulés et leurs habitants exécutés. Clément XI s'en lava les mains.
* __Clément XII__ : né en 1652, (1730-1740) rétablit deux choses : les jeux de loteries et la "mazzolatura" (exécution capitale par rupture des os à coups de bâton)
* __Clément XIII__ : né en 1693, (1758-1769) Se fit remarquer en mettant à l'index les ouvrages de Voltaire et de Montesquieu mais surtout en demandant que tous les zizis et toutes les foufounes de la chapelle Sixtine qui n'avaient pas été cachés par un voile sous le règne de Paul IV, le soit désormais !
* __Clément XIV__ : né en 1705, (1769-1774) Interdit l'usage de la castration (destinée à obtenir chez les hommes des voix lyriques très aiguës.) Sa mort fait l'objet de deux versions : soit empoisonné (à l'aide d'une pastèque) par l'officier dégustateur chargé de tester les mets, et que les jésuites auraient soudoyés, soit mort après s'être enfermé volontairement dans ses appartements, persuadé qu'on cherchait à l'assassiner.
* __Pie VII__ : né en 1742, (1800-1823) Il fallut plus de trois mois de conclave pour élire ce pape. Fait prisonnier par Napoléon 1er de 1812 à 1814 à Fontainebleau pour l'avoir excommunié à la suite de l'annexion des Etats de l'Eglise. Son nom de pape a fait rire des générations de séminaristes.
* __Léon XII__ : né en 1760, (1823-1829) condamne la vaccination antivariolique - µ(''Quiconque procède à la vaccination cesse d'être un fils de Dieu, la variole est un châtiment voulu par [Dieu|ListeDeCitationsSurDieu], la vaccination est un défi contre le ciel'')µ
**Sous son pontificat, les prisons vaticanes logeaient 8000 prisonniers politiques. Pour comprendre la criminalité de ce Pape, il suffit de se rappeler que lorsque les patriotes de l'unification italienne entrèrent dans les prisons pontificales pour libérer des dizaines de prisonniers qui y croupissaient, enchaînés depuis une si longue période qu'ils avaient perdu la vue et l'usage de leurs membres, ils trouvèrent dans ces souterrains des tas de squelettes et de cadavres en décomposition dans un mélange de soutanes de moines et de sœurs, de vêtements civils d'hommes et de femmes, d'uniformes militaires et de chaussures, comme lorsque furent libérés les camps d'extermination nazis. On y trouva aussi des jouets d'enfants, morts avec leurs parents. En 1848, la population de Rome se révolte contre la dictature papale. Le pape est chassé mais remis au pouvoir en 1849 par les troupes françaises. Les opposants sont fusillés. L'état de l'Eglise redevient une monarchie absolue dont le souverain est le pape.
**en 1864 ce pape en pleine forme dénoncera "Le mariage civil, la tolérance en pays catholique de rites d'autres religions, la liberté de religion, le panthéisme, le libéralisme, le socialisme, la rébellion contre un souverain "légitime", la critique au pouvoir temporel du pape, la possibilité de progresser par la raison, la non-intervention du religieux dans les sciences et la philosophie". En 1866, il justifie l'esclavage. Et afin d'être sur d'avoir toujours indubitablement raison, Pie IX convoque le concile Vatican I en 1870 afin de faire proclamer le dogme de l'infaillibilité pontificale en matière de foi et de morale. Garibaldi désignait ce pape sous le nom de "''mètre cube de fumier''".
**En 1881 lors du transfert de sa dépouille la population romaine tenta de s'en emparer pour la jeter dans le Tibre. Malgré tout ça, alors que ces méfaits peuvent s'assimiler à des crimes contre l'humanité, il fut béatifié par Jean-Paul II en l'an 2000.
[http://home.nordnet.fr/~caparisot/images/pieneuf.jpg]
%%Center(__1870 : Disparition de facto des Etats Pontificaux__)%%
* __Léon XIII__ : (Vincenzo Pecci) né en 1810, (1878-1903) Après le cauchemar du pape précédent, celui ne pouvait qu'être mieux. Parfois surnommé le pape des ouvriers, (pour sa condamnation du capitalisme) ce qui ne l'empêcha pas de condamner aussi le socialisme... Organisa le rapprochement des catholiques français avec la république (au grand dam du clergé vendéen qui se mit à prier... pour la conversion du Pape !) A sa mort, les caisses du Vatican sont vides...
* __Pie X__ : (Giuseppe Sarto) né en 1835, (1903-1914) De nouveau un pape hyper réac ! Désapprouva la loi de séparation de l'église et de l'état en France (encycliques Vehementer nos). Condamna le "modernisme". Affirme le caractère historique des faits relatés par la Genèse ! Béatifie Jeanne d'Arc à la demande du clergé français et pour embêter les laïques. Choqua les américains en refusant de recevoir le président Théodore Roosevelt (parce qu'il était protestant)
* __Benoît XV__ : (Giacomo della Chiesa) né en 1854, (1914-1922) Le pape de la guerre de 14-18. Ouvertement pro-Allemand (même si ce derniers pensaient qu'il n'en faisait pas assez). Surnommé "le pape boche" par Georges Clemenceau et Pilate XV par la presse française. Canonise Jeanne d'Arc uniquement pour satisfaire le clergé français... qui trouvait que la béatification ce n'était pas encore assez. A sa mort, les caisses du Vatican sont de nouveau vides... [http://www.sainte-agonie.fr/images/assoc/organ-Benoit-XV.jpg]
* __Pie XI__ : (Achille Ratti) né en 1857, 1922-1939) Alpiniste et amateur de voiture de courses, il approuvera la montée des régimes totalitaires en Europe. Création de la cité du Vatican (11 février 1929) comme état indépendant suite à la signature des accords de Latran entre le pape et Mussolini. Ce dernier est qualifié par le pape ''d'homme de la providence !'' En 1931 : naissance de Radio-Vatican. En 1933 Pie XI demande au cardinal Pacelli (le futur Pie XII) d'entamer des négociations avec le Reich Nazi, un concordat est signé au terme duquel Hitler déclarera : ''"La conclusion du concordat me paraît apporter la garantie suffisante que les citoyens du Reich de confession catholique se mettront dorénavant sans réserve au service du nouvel Etat national-socialiste."'' µµCommuniqué de presse du 10 juillet 1933.µµ Pie XI en vieillissant modifiera son point de vue, En mai 1938, il disparaît du Vatican afin de ne pas être présent lors de la visite d'Hitler à Rome. Il demandera aux universités catholiques de prendre position contre l'antisémitisme. Et surtout : convoqua pour le 11 février 1939 tous les évêques d'Italie afin de prononcer un discours dénonçant les persécutions raciales perpétrés par les nazis... mais le pape mourut dans la nuit du 10 février (officiellement de mort naturelle).µµLe contenu du discours ne fut rendu public qu'en 1959 par Jean XXIII µµ
* __Pie XII__ : (Eugenio Pacelli) né en 1876, (1939-1958) Ancien nonce apostolique en Allemagne pendant la montée du nazisme, signa à ce titre en 1933 le concordat entre l'Eglise et le régime nazi. Déclara ignorer le sort des juifs pendant cette période, même après avoir été informé. (Deux juifs hongrois évadés du camp d'Auschwitz (R. Vraba et A. Bestic) font parvenir au Vatican, via le Nonce apostolique de Slovaquie, un rapport détaillé sur la situation dans le camp, le rapport sera enterré. Lorsque les juifs de Rome sont raflés en plein ghetto, le 16 octobre 1943, le pape se refuse à protester publiquement, (et ce ne sont là que quelques exemples). Une note du Foreign office britannique au sujet de ses relations avec les dirigeants fascistes croates décrit Pie XII comme "le plus grand couard de l'époque". A la libération protesta auprès des autorités militaires américaines de la présence de soldats de couleurs au Vatican. Condamne les prêtres-ouvriers. Dans un genre plus insolite, fut aussi le seul pape à voir des soucoupes volantes. (''En 1950, il voit [le soleil "danser"|ListeDeMiracles] plusieurs fois dans le ciel depuis les jardins du Vatican puis, lors de la grande vague d'OVNIs de 1954, il observe 2 apparitions divines "semblables à celles de Fatima"''). Mort en 1958 des conséquences d'une crise de hoquet. µµ([plus de choses ici|http://marjorie-art.voila.net/Pie_XII.htm])µµ
**en 1961 paraît la dernière édition de l'index (Index Additus Librorum Prohibitorum), qui cite comme auteurs dont l'ensemble de l'œuvre est interdite de lecture aux catholiques, entre autres : Jean-Paul Sartre, Alberto Moravia et André Gide. Par contre "Mein Kampf" d'Adolf Hitler n'a jamais figuré dans l'index...)[http://pagesperso-orange.fr/lemomo2/jean23.jpg]
* __Jean-Paul II__ : (Karol Wojtyla) né en 1920, (1978-2005) Premier pape non italien depuis Adrien VI en 1522, son élection fut une énorme surprise, qu'un évêque polonais puisse être élu alors qu'on connaît le poids énorme de la curie romaine et du collège des cardinaux italiens qui ne manquait pourtant pas de candidats constitua une énorme surprise ! Sans qu'on puisse le prouver on parle de la main de la CIA américaine qui en le faisant élire (par l'intermédiaire du cardinal de Philadelphie John Krol) aurait cherché à accélérer la chute du bloc communiste, notamment en déstabilisant la Pologne (c'est ce qu'on appelle la théorie des dominos). Très critiqué notamment sur son obsession moraliste en matière de sexualité... mais peut-on demander à un pape d'être autre chose qu'un pape ? Adepte de l'auto-masochisme il se flagellait avec sa ceinture avant de trouver le sommeil. Fut recalé au prix Nobel de la Paix en 2003. Anticommuniste acharné (normal pour un pape), il fut très gentil avec les dictateurs de l'autre bord, notamment Pinochet qu'il alla voir et avec lequel il vint saluer la foule au balcon. 8 ans après sa mort, le monde semble de façon incompréhensible avoir oublié tout ce qu'on pouvait lui reprocher de son vivant[http://www.radio-canada.ca/nouvelles/dossiers/pape/img/internet.jpg]%%Center(µ...Ab Risum Casso µ)%%
**µµqualifié de "Berger Allemand" par la presse de gauche italienne ! ...et de "BEN SIXTEEN" au Québec ! ...et de "Papa Ratzi" par les marchands de souvenirs de Rome... et de XIII et III par d'autres encore ! µµ
*Né en 1960, le mouvement Legio Maria (les légions de Marie) revendique 3 millions de fidèles. Il s'agit d'un mélange de christianisme et d'animisme crée par "Babba Messie" à sa mort, un pape fut chargé de diriger la communauté
**__Timothy Blasio Ahitler__ (1991-1998) (un nom pareil, ça ne s'invente pas !)
*__Manfreda__ morte sur le bûcher en 1300, cousine du vicaire impérial de Milan, désignée comme papesse par Guillelma, nomma des cardinales et serait à l'origine de la figure de la papesse dessinée sur les jeux de tarot
Papes scissionnistes µµ(par ordre alphabétique)µµ
*__Grégoire XVII__ (ce n'est pas le même ! Se fait parfois appeler Jean-Grégoire XVII) Jean-Gaston Tremblay, Canadien, (1928-2012) se proclame le successeur de Clément XV en 1968. Possède une très grande propriété à Sainte-Jovite. Inquiété par la justice canadienne pour des affaires de mœurs. Aurait confié sa future succession à une papesse, Gregoria XVIII, mais depuis le décès du gourou on n'en entend plus parler.
*__Grégoire XVII__ : Non de pape attribué par une légende "complotiste" à Giuseppe Siri (1906-1989), archevêque de Gênes. Selon leurs auteurs, Siri dont Pie XII avait fait son dauphin aurait obtenu la majorité des voix au conclave de 1958, il aurait dans un premier temps accepté d'être pape sous le nom de Grégoire XVII pour ensuite se rétracter rapidement sous pression (?). Cette rumeur trouve son origine dans un cafouillage dans la couleur des fumées pendant ce conclave. Bien que les délibérations des conclaves soient sous secret, tout finit par se savoir et aucun ouvrage sérieux consacré à leurs délibérations n'est venu confirmer cette thèse. Siri a tenu parfois des propos pouvant paraître ambigües à ceux qui ne comprennent pas qu'en fait, l'immense désespoir de sa vie a été de ne jamais être élu pape et qu'il n'a jamais vraiment digéré ses défaites...
* __Léon XIV__, québécois nationaliste et royaliste, né en 1975, membre de la communauté de Jean-Grégoire XVII entre 2003 et 2006, pape depuis 2005, ("Dieu retira la tiare de Grégoire XVII pour ensuite me la mettre sur sa tête"). Se prétend "ermite moderne dans un sous-sol à Montréal ne vivant que de charité et de prière." ce qui ne l'empêche pas d'avoir un [site web tenu à jour|http://eglisenouvellefrance.org/] et d'y développer des idées aussi farfelues que rétrogrades. Ne se manifestant que sur la toile, ce Léon XIV serait donc le premier pape virtuel ! Se prend aussi pour le roi de France. S'est prononcé en 2013 pour le mariage g&#97;y, mais attention parce que... le véritable mariage n’est jamais sexuel et sera toujours asexué...
* __Linus II__ (ou Lin II - Victor Von Pentz, Sud-Africain né en 1953, vit en Angleterre), séminariste dans le Minnesota, est élu par un conclave réuni à Assise en Italie le 25 juin 1994. Quatre jours plus tard, ses partisans tentent de pénétrer au Vatican pour l'installer à la place de Jean-Paul II mais se font refouler par la police.
*__Pie XIII__, en 1998 une assemblée de religieux catholiques (tendance intégriste) décréta que les 4 papes ayant succédés à Pie XII étaient des usurpateurs, que par conséquent le siège papal était vacant depuis 40 ans et qu'il y avait donc urgence à élire un nouveau pontife. Pie XIII (Lucian Pulvermacher) fut donc élu suite à un conclave par téléphone. Cet hurluberlu inconnu né en 1918 possède sa [page internet|http://www.truecatholic.us/] (pas toujours accessible) et ferait passer JP2 et Ben16 pour de dangereux progressistes. Décédé en 2009 sans laisser de successeur.
*__Pierre II__, (Maurice Archieri, né en 1923). Mécanicien automobile en retraite habitant Le Perreux en banlieue parisienne, investi par l'opération du Saint-Esprit (sic) en 1995. (autre tendance intégriste) Possède [un site incompréhensible|http://custodi.perso.neuf.fr/index.htm]. Son fils Jean-Marie Archieri, (né en 1951) et lui même ont été consacré évêques en 2002 par un évêque de l'église catholique gallicane belge.
*__Pierre II__ (ce n'est pas le même !) (né en 1934) de son vrai nom Manuel Alonso Corral, auparavant "Père Isidore" a pris la succession de Grégoire XVII en 2005 à la mort d'icelui (voir plus haut).
* __Pierre II__ (encore un autre, William Kamm, allemand né en 1950, vivant en Australie. La Vierge Marie lui aurait directement conseillé de sélectionner pour épouses 12 reines et 72 princesses, qui lui permettraient de redévelopper la race humaine après sa destruction par une boule de feu. Ce qu'il s'est empressé de faire. Le problème est que deux de ces jeune filles était mineures et qu'il a écopé de 10 ans de prison ferme pour agression sexuelle !
* __Christophe XVIII__ (Mathias Vigan, au Bénin) Pape depuis le 17 novembre 2012. Choisi directement par Dieu, réincarné dans le corps de Soeur Parfaite (ou Parfaite de Banamé mais de son vrai nom Vicencia Chanvoukini, née le 18 avril 1990). ''Mais pourquoi ce numéro 18 ?)
***C'est ce que devait déclarer un diacre après l'élection du St Père. L'église échaudée par l'épisode de la papesse et ne souhaitant pas qu'elle se renouvelle, entreprit de faire vérifier la masculinité des papes. Le rite perdura jusqu'au 17e siècle. La position officielle de l'église moderne est de dire que ce rite n'exista jamais... air connu.
**µµC'est le pape qui fait une ballade dans sa papamobile, et comme il s’ennuie, il demande au chauffeur de lui laisser la place, (il y a si longtemps qu’il n’a pas conduit). Le pape prend le volant, se met à rouler à fond la caisse et se fait arrêter pour excès de vitesse ! Le flic s’aperçoit que c’est le pape qui conduit ! Il regarde sur le siège arrière, puis téléphone à son chef ! " - Chef, on a arrêté un mec, on sait pas qui sait mais ce doit être quelqu’un de super important parce que c’est le pape qui conduit !µµ
**µRaspail fut convoqué par le premier ministre de l'époque (Balladur) qui se demandait pourquoi certains ecclésiastiques semblaient préoccupés par cette publication...µ
* __Celestin VI__ : C'est le Cardinal Melville qui est élu pape dans le film de Nanni Moretti, Habemus Papam (2011, incarné par Michel Piccoli)[http://www.avoir-alire.com/IMG/jpg/habemus-papam-teaser-1-anglais-sous-titre.jpg]
* __Francis__ (déclinaison anglaise de Francesco !) dans le roman de l'américain Walter F. Murphy paru en 1979. Il avait donc imaginé que le premier pape issu du continent américain prendrait le nom de Francesco (François)!
* __Hadrien VII__ : Un pape anglais, dans le roman éponyme du Baron Corvo (1860-1913) paru en 1904
*__Hyacinthe 1er__ : dans 3 romans de Gérard Bessière illustré par Piem (Le pape a disparu - 1972. Le pape reparaît - 1973. Le pape meurt à Jérusalem - 1989) pas si mal...
* __Jean-Clément Ier__ : Dans Meurtre au Vatican de Marcello Aliprandi (1982) avec Terence Stamp dans le rôle du pape, empoisonné quelques jours après son élection. (en fait une paraphrase sur la version criminelle du décès de Jean-Paul 1er)
* __Jean-Paul 1er__ : Empoisonné après 33 jours de pontificat comme peut-être le vrai, dans le Parrain 3 de Francis Ford Coppola (la seule différence est dans le nom d'évêque, Monseigneur Lamberto dans le film, Albino Luccini dans la réalité.
* __Khomèfre 1er__ : Paponyme forgé par Germain Clavien dans "Le Mulot" - 1988 (paponyme valise à partir de Kkomeny et de Lefebvre)
*__Paul IX__, dans 32 décembre (2003), bande dessinée d’Enki Bilal parue aux Humanoïdes Associés.
*__Pie XIII__ dans le roman "La papesse du diable" de Jehan Sylvius et Pierre de Ruynes (1931, réédité par Losfield en 1966). Sous ces pseudonymes se cacheraient Ernest de Gengenbach et Robert Desnos.
*__Pie-Innocent 1er__ dans "Le dernier pape" par Jerry Marcus (1997)
*__Sixte VII__ dans la nouvelle "Bonnes nouvelles du Vatican" de Robert Silverberg (trouvable en Livre de Poche dans le recueil Histoires divines - 1982) C'est un pape robot métallique qui se déplace sur chenillettes et qui possède des réacteurs de lévitation. Il s'agit du premier pape entièrement réparable.
* Pape Ôté : µspectacle de strip-tease masculin interdit par la préfecture de police en 1979. Cela avait lieu dans un théâtre érotique parisien aujourd'hui disparu et qui une fois par semaine donnait un spectacle Gay, le show en question montrait simplement des jeunes hommes habillés en dignitaires ecclésiastiques qui se déshabillaient en musique ("Jésus que ta joie demeure" de J. S. Bach)µ
# Par symétrie, 3 = 2.
* [Pape de quelque chose|ListeDePoncifsJournalistiques] (on parle parfois du pape du surréalisme (__André Breton__) du pape de ceci, du pape de cela, c'est fou le nombre de papes qu'il y a parfois...)
%%Image(http://arts.clg.berlioz.online.fr/doc4e/popart/turquoise-marilyn_andy-warhol.jpg,250,250)%%
* Pape Atango Charlie, disparu dans les Bermudes.
* Pape Erdu, promoteur des chemins de fer, possède une salle dédiée à sa mémoire à la gare St Lazare à Paris.
* __André XXIII__, nommé archevêque de Paris, le 11 février 2005 en remplacement du cardinal Lustiger qui se sentait un peu vieux.
*__(2)__ :''µLe dogme de l’immaculée conception est souvent confondu (cf Lafargue) avec celui de la naissance virginale de Jésus (qui est tout simplement le dogme de l'Incarnation) et certains pensent que Marie elle-même serait née aussi d’une naissance virginale. Or il ne s’agit en rien de tout cela. Le dogme, promulgué en 1854 par le pape Pie IX concerne la naissance de Marie, et non celle du Christ et il affirme que tout en ayant été conçue naturellement d’un homme et d’une femme, Marie n’a pas hérité du péché originel, comme c’est le cas pour tous les humains qui viennent au monde.µ''
*D'autres [listes pas toujours respectueuses en rapport avec la religion|ListeDeListesPasToujoursRespectueusesEnRapportAvecLaReligion] - Et un grand merci à ce site qui nous a fourni de précieux renseignements sur [les papes "hors catégories"|http://membres.lycos.fr/papocryphes/] et à celui-ci qui nous parle des [antipapes "modernes"|http://marjorie-art.voila.net/Drole_de_papes.htm]
ListeDePeugeotBoeingFiatAirbusEtc
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* 104 µ(la mienne roule encore, après douze contrôles techniques et trois tonneaux - il y a eu par ailleurs la version deux roues et la chignole)µ
* 8,6 et XX, bières (la seconde, sous le nom développé de ''Dos equis'', sévit également au Mexique, mais là-bas, c'est de la supérieure - pas comme la Corona, réservée aux ânes et au Amerlopes ! - ainsi qu'au plus grand voleur de France, durablement protégé par la divine providence (avec l'aide d'un gangster complice, chaussé par Elf et par Berluti))
Liste démarré par Mr O. - µplus calé en Boeing qu'en Peugeot...µ
ListeDesQuatrePechesQuiCrientVengeanceAuCiel
/* par PITIE ne mettez pas de liens vers de GROS péchés. merci
* (d) le Medef [http://placedupre.hautetfort.com/images/medium_parisot.jpg]
* (h) L'amour : " Au début pour faire l'amour..., et je ne parle pas que de sexe..., il faut être physical, mais ensuite, il faut être plus mental, et après quand tu as un enfant, il faut être spiritual pour bien l'élever.
* (h) les pauvres : "Y a des gens qui n'ont pas réussi parce qu'ils ne sont pas [aware|ListeAware], ils ne sont pas "au courant". Ils ne sont pas à l'attention de savoir qu'ils existent. Les pauvres, ils savent pas. Il faut réveiller les gens. C'est-à-dire qu'y a des gens qui font leur travail, qui font leurs études, ils ont un diplôme, ils sont au contact tout ça. Tu as un rhume et tu fais toujours "snif". Faut que tu te mouches. Tu veux un mouchoir ? Alors y a des gens comme ça qui ne sont pas aware. Moi je suis aware tu vois, c'est un exemple, je suis aware.
µµListe créée par Pierre L. et bricolé le matou dormitifµµ
ListeDePhrasesCultesDePub
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(%%Red(par ordre alpha des marques ! )%%)%%
* __Air Inter__, un départ toutes les trente secondes dans toutes les directions
* Pour parler franchement, votre argent m'intéresse (__B.N.P.__)[http://idata.over-blog.com/1/42/12/52/Photos-Cultes/BNP.jpg]
* __Babette__, je la lie, je la fouette, et parfois elle passe à la casserole.
* L'eau du __Boulou__ est en vente partout
*__Caisse d'Epargne__, là où est l'écureuil
* __Carglas__ répare, Carglas remplace.
*__Eparcyl__, la fosse tranquille
** __Essssooooooooooo__, le plein de cadeaux (avec les animaux qui parlent de Bouchitay)
** __Evian__, déclarée source de jeunesse par votre corps
* Oui-Non de __Kookai__, parfum d'extrait d'essence de fille
*__L'Oréal__, parce que vous le valez bien
* Goutez les bienfaits de la Chicorée __Leroux__ ''(sans doute la marque qui s'est toujours distingué par l'extrême platitude de ses slogans)''
* Un coup de barre, __Mars__ et ça repart
** ''Détournée par Stéphane Collaro : Des putes, des putes, oui mais de __Tanzanie__ !''
* __Paris-match__, le poids de mots, le choc des photos
* Pourquoi __Picon__ ? Parce que c'est bon !
* Et c'est tant mieux, parce que je ferai pas ça tous les jours ! (__Pliz__)
* (Avec __Roc__, je crois) vos rides paraissent 10 ans de moins ! (Ce qui vous permet d'être vieille avec des rides jeunes)
* "Quand l'estomac parle... avec les mains..." ''(chanté)'' __Twix__, deux doigts coupe- faim
* Du beau, du bon, __Dubonnet__, c'est un quinquina parfait, buvez-en quand ça vous plaît, du beau, du bon, __Dubonnet__ !
* Avec __Martini__, Martini, Martini, le monde entier chante et sourit, on en boit de New-York à Paris, y'a rien d'meilleur qu'un bon Martini, et si vous voulez régaler vos amis, offrez un Martini... ''(sur l'air de Pas sur la bouche de Maurice Yvain)''
* Certains dialogues de pub ont parfois atteint le sommet du ridicule ainsi celui-ci :
µµListe créée par El Jj -- et on ne signe pas ses contributions, merci ! µµ
ListeDesQuatorzeSignesDuZodiaqueEcholaliens
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Liste établie l'echodredi 12 echovembre, à 328 h par El Jj
ListeDesEaux
/* par PITIE ne mettez pas de liens vers de GROSSES eaux. merci
* château d'- [http://cfpphr.free.fr/images/sce58stparize01.jpg]
* conduite d'- µ(par exemple un %%Link(aqueduc,http://planetejeanjaures.free.fr/histoire/gaule/images/aqueduc.gif)%%)µ
* de la reine de %%Link(Hongrie,http://www.cofrase.com/triangledor/dossiers/parfums/images/parf3.jpg)%%
* de parfum
* [ligne|ListeDeLignes ] de partage des -
* Par l'O (Cycle de Cyan)
* parot
[http://www.aquamania.net/images/salon%20visite/Parot2001/bouteille2.gif]
* [porteuse|http://www.paroles.net/chansons/20330.htm] d'-[http://www.sculpturepublique.be/1060/Dillens-PorteuseDEau.jpg]
* ''Vous savez, où vous pouvez vous la carrer, l'eau ?'' Parce que l'eau s'carre !
[http://www.metropoleparis.com/2000/519/effel519b.jpg]
%%Center(__Les antialcooliques sont des malades en proie à ce poison, l'eau, si dissolvant et corrosif qu'on l'a choisi entre autres substances pour les ablutions et lessives, et qu'une goutte versée dans un liquide pur, l'absinthe, par exemple, le trouble__.%%%''Alfred Jarry'' µµla veille de son centenaireµµ)%%
* [Musée du vin|http://www.museeduvinparis.com/], à Paris
%%Image(http://www.museeduvinparis.com/img/plan.gif,200,155)%%
ListedEquations
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*** µIl est à noter qu'au-delà du quatrième degré les équations polynomiales ne sont généralement pas solubles par radicaux (E.Galois)µ
* les équations aux dérivées partielles (EDP)
ListeDeDieux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Allah (aussi nommé l'Eternel, Le Saint, le Rassembleur, Le Guide, le Créateur, Celui qui compte, le Seigneur, l'Evident, le Purificateur, l'Etabli, celui qui accepte, le Stable, celui qui se souvient, le Matriciant Matriciel, le Miséricordieux, le Punisseur, l'Exalté, le Grand Pardonneur, lave plus blanc, celui qui ouvre, le Puissant, le Suffisant, le Bénin, le Chef, le Roi, la Lumière, la Vérité, l'Ami)
**µµoui bon ça va, les chrétiens, à ce moment là vont tout mettre en "ne convient pas" parce qu'il n'y a qu'un seul Dieu... et les musulmans itou...µµ
* Elohim µµeeeuuuuuh...µµ µ(elohim = "les dieux" en hébreu, selon une des traditions de l'ancien testament (dite elohiste), ce qui est traduit généralement par "Dieu" en français, tout comme l'est le YHWH de la tradition yahviste, juste pour nous faire croire qu'ils étaient monothéistes du début, pfuh!)µ
* Inari : Divinité japonaise dont le culte semble remonter au 8ème siècle (avant d'être "récupérée" par le bouddhisme et le shinto). Représenté par un renard, parfois mâle, parfois femelle elle est la protectrice de l'agriculture, des manufactures, du commerce et de la pêche, mais aussi des prostituées et des pompiers. Son culte perdure encore aujourd'hui au Japon.
* Ishtar : (Inanna, "la Dame du Ciel", en sumérien) Déesse principale de la Mésopotamie, vénérée à Babylone, déesse de l'amour (physique) et de la guerre, elle était aussi la déesse des prostituées (un temple lui était dédié à ce titre). Avoir des relations sexuelles avec une prêtresse de ce temple permettait d'être absous de ses "péchés" (à condition de s'acquitter d'un don). Ishtar était la promotrice de toutes formes de sexualité, (le seul tabou notable étant l'inceste). Parmi ses nombreux titres figurait celui de "Grande prostituée". Jean l'évangéliste y fera une référence horrifiée dans le Livre de l'Apocalypse "...Babylone la grande, mère des prostituées et des abominations de la terre...[http://paganpages.org/content/wp-content/uploads/2010/03/ishtar_2.jpg]
** Plus connu comme personnage de ''South Park''
** Sinon ''Jésus'' ça veut dire simplement "Sauveur" (''Sôter''), et comme "Christ" veut dire "oint" - Jésus-Christ = le sauveur oint - c'est même pas un nom au départ, juste de vaines vaticinations, mais bon: c'est juste un pitit détail.
* Le Ouaibmestre (µLe [Ouaibmestre|ListedeDebats] est tout-puissant, infini et éternel. Le Ouaibmestre est infiniment juste, parfait, sage, saint et bon, omnipotent, omniscient, et __omniprésent__, c'est-à-dire présent partout et n'importe où et dans tous les temps en même temps. La perfection du Ouaibmestre excède infiniment plus ce que tout listeur peut imaginer ou démontrer.Le Ouaibmestre n'est pas un listeur parmi tant d'autres mais le Listeur absolu et illimité)µ
** µµça vous rassure, hein, des flatteries pareilles après la liste anarchiste... Pffffffµµ
*%%Red(Thouze (dieu de l'amour on ne jurais que par lui ( par Thouze))%%
* Xceptunic : Dieu du panthéon maya, figuré par des monolithes phalliques qu'on retrouve au Yucatan - Sur l'image : monolithe phallique de la Picota (site archéologique d'Uxmal, Yucutan, Guatemala)[http://lassilia.voila.net/Image_dico/monolithe_Picota.jpg]
%%Center(µµpar rapport au graphique de 2002, l'Islam perd 1 point, L'Hindouisme perd un point et la non-religion gagne 2 pointsµµ)%%
**En effet, on parle toujours de ''Dieu et sa grande Clémence''. µ(voire de ''Dieu dans sa grande Clémence...'')µ
* Gérard Depardieu
µµListe confectionnée avec amour et tendresse par LNµµ
ListedeNomsdeBars
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* En face de la prison de Fresnes : un bar nommé ''"ici mieux qu'en face"'' (il n'existe plus ) l'état lui avait fait un proces, gagné par le bar.µCf ci-dessus. D'où l'interet d'ordonner les listesµ
** µLes deux mon général. Vous croyez qu'il n'y a qu'un "Café de la Poste" de par le monde ?µ
* L'Opéra Café, 71 rue de Lyon, quasiment place de la Bastille, établissement datant de 1923, anciennement Café Opéra jusqu'en 2007. Mystérieusement fermé du jour au lendemain un jour de septembre 2013. Repris par la brasserie "Chez Félicien"
* L'Oriental à Valensole µµ(Ainsi nommé parce qu'il est situé 20 mètres à l'est du Café des Sports)µµ
* La Consigne, Paris-Porte de la Vilette à l'angle du Boulevard Mac Donald
* La Lune (au coin de la rue St Denis et du Boulevard Bonne-Nouvelle à Paris)
* La Traversée de Paris
**Il y en a deux à Paris, un rue Poliveau (5ème) en référence au film d'Autan-Lara, l'autre rue Traversière, près de la Gare de Lyon (du grand n’importe quoi parce que Traversière n'évoque aucune traversée mais le nom d'un jardinier qui habitait le coin.
* Le bar de chez Virgin (Champs Elysées à Paris) superbe vue sur le décolleté des minettes en train de fureter dans le rayon CD
* Le bar des Galeries Lafayette à Paris (pas cher et superbe vue sur les toits de Paris et en particulier sur celui de l'Opéra)
* Le Bar des Initiés (!) Paris 1er place de l'Ecu
* Le Bar Parallèle
* Le [bar-tabac de la rue des Martyrs|http://www.paroles.net/chansons/13484.htm]
* Le Berverley (Dans le quartier de la rue St Denis à Paris)
* Le Central (angle de la Ste Appoline et du Boulevard Sébastopol, Métro Strasbourg-St Denis, on y fait parfois d'interessantes rencontres)
* Le Cerneau (Paris, angle de la rue de Tracy et du Bd de Sébastopol) Le meilleur "café crème avec tartine" de tout le quartier St Denis)
* Le Commerce (rue Clignancourt, Paris 18e - les serveuses sont accortes et le steak tartare succulent)
* Le Départ
* Le Dôme, rue Belhomme près du métro Barbés à Paris. Affichait à l'entrée un panneau dans les années 1980 : "Interdit aux trafiquants"
* Le Flore (Paris - St Germain des Près)
* Le Guillaume-Tel à l'angle des rues Etienne-Marcel et Lescaux dans le quartier des Halles à Paris, ''µj'y ai attendu un jour la pulpeuse Gina pendant une heure et quart avant de réaliser que nous n'avions rendez-vous que le lendemainµ''
* Le Mac-Mahon (Paris 17ème - sur l'avenue du même nom, Métro Etoile) devenu le MC.
* Le Petit Parmentier µ(merci Monsieur Belloc !)µ
* Le Phocéen, à Marseille pardi!
* Le Rallye Tournelle, à Paris en face du Pont de la Tournelle
* Le Roi Soleil, à Paris
* Le Select (Angle des Rues St-Denis et du Caire à Paris)
* Le Sorbon (rue des Ecoles à Paris 5ème)- sans doute le café ou il est possible de rencontrer périodiquement d'absolus farfelus, ainsi un type qui commandait un bol de lait avec 14 tartines (pour lui et son ami), ou cet autre qui essayait d'accrocher ensemble des feulles A4 avec du fil et une aiguille...
* Le [Tubercule Agile|http://tuberculeagile.free.fr/] (Paris, Bastille)
* Le Vizir ( Avenue des Ternes à Paris 17ème)
* Les deux magots (Paris - St Germain des Près)
* Bar à Gouines µµpar contre le Bar à Gouin (Paris 4e) convient tout à fait.µµ
*''Remarque&nbsp;: Au départ cette liste était une énumération de noms de bar courants (cf un sketch dans la pièce ''Brèves de comptoir''). Donc éviter de donner des adresses sauf cas très particuliers !''
**''µ1) tous les cas sont particuliersµ''
* Dans les innombrables déplacements férroviaires accomplis pendant ma carrière, j'ai remarqué comment les bistrots devant les gares pouvaient porter des noms originaux. Trois fois sur quatre en effet, j'avais droit à un __café de la gare__ ou à __l'arrivée__ ou encore __au départ__, voilà qui avait le don de m'énerver et j'évitais donc ces lieux jusqu'au jour ou (à Montpellier, je crois) la présence d'un Mac Do devant la Gare me réconcilia subitement avec les susdits estaminets.
** C'est fait, mais, par pitié, ne remettez pas en branle votre automate qui rase tout ! %%Green(__''C'est une contrepèterie ?''__)%%
''*µC'est un wiki, on signe sa liste à sa création en en faisant don à la communauté, par contre il n'est pas d'usage de signer ses contributions.µ''
Liste lancée par un pôvre homme abruti par le redoutable %%Green(__''beaujolais nouveau''__)%%
ListedAphorismes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Avoir des enfants ne fait pas plus de vous des parents qu'avoir un piano ne fait de vous un pianiste. ''Michael Levine''
* Ce n'est pas parce qu'on dit ce qu'on pense qu'on dit la vérité. ''[Sacha Guitry|ListePourSachaGuitry]''
* Ce n'est pas parce qu'on dit des phrases compliquées que l'on est intelligent.
* Ce n'est pas parce qu'on est au régime qu'il faut s'abstenir de regarder la carte !
* Ce n'est pas parce que les choses sont difficiles que nous n'osons pas, c'est parce que nous n'osons pas qu'elles sont difficiles. ''Sénèque''
* De la modération en toute chose. Y compris, et surtout, dans la modération. (je crois que Pétrone a écrit quelque chose dans ce goût là, sinon cf Paracelse : tout est poison, rien n'est poison, l'important c'est la dose ! -- Double pour moi ! Merci)
* En politique, une absurdité n'est pas un obstacle. ''Napoléon Bonaparte''
* Il n'y a pire mal qu'une mauvaise femme, mais rien n'est comparable à une femme b__OO__nne. ''Euripide''
* Il y a eu un moment dans l'histoire où il ne fallait pas toucher à la [Joconde|ListeDeVariationsSurLaJoconde]... parce que c'était pas sec.
* J'aime les gens qui s'écoutent parler, mais j'aime surtout les écouter se taire. ''[Philippe Geluck|ListePourPhilippeGeluck]''
* Le fou rire n'est pas soigné par les psychiatres ![http://www.ultim8team.com/~iokanaan/blog/book_JonathanCarroll_LePaysDuFouRire.jpg]
* Le mépris ne gagne pas nécessairement à être exprimé ; d'ailleurs il est transparent à celui qui méprise vraiment.
* Le monde appartient à ceux qui ont des ouvriers qui se lèvent tôt.
* Le poney ne réclame jamais un tour de manège supplémentaire à ses parents
* Les femmes pardonnent parfois à celui qui brusque l'occasion mais jamais à celui qui la manque
* Méfiez-vous de ceux qui penchent toujours de votre côté : ils finissent par vous tomber dessus...
** µPour ma part, je préfère prendre la Germaine en levrette.µ
* Mieux vaut une petite courageuse qu'une grosse paresseuse
* Mon cul, personne ne peut le voir (à part quelques personnes privilégiées), mais pourtant tout le monde sait qu'il existe !
* On n'arrête pas de jouer parce que on vieillit, on vieillit parce qu'on arrête de jouer.
* On n'est jamais si bien branlé que par soi-même. (Gérard de Nerval, µcité dans le dictionnaire érotique de Alfred Delvau 1864µ)
* On ne devrait parler que de ce que l'on connait, on dirait moins de conneries ''[Pierre Desproges|ListeDesproges]''
* Plus le blanc devient bête, et moins le noir lui parait intelligent. ''André Gide''
* Quand la merde vaudra de l’or, le cul des pauvres ne leur appartiendra plus. ''Henry Miller''
* Si les trains partaient un peu en avance, ils arriveraient toujours à l'heure
* Si, passé 50 ans, en te réveillant tu n'as pas mal au moins quelque part, c'est que t'es mort.
* Tout à l'heure, Christelle m'a dit je prends l'ascenseur ! J'ai trouvé ça prétentieux, parce qu'en vérité c'est le contraire, c'est l'ascenseur qui la prend.
* Si le roi Dagobert eut été naturiste, il aurait été moins ridicule !µµTu parles d'un aphorisme !µµ
* Un coup de bar et ça repart-- µµce n'est ni un aphorisme, ni un proverbe, µµ
*Proposition de définition : Proposition résumant à l'aide de mots peu nombreux, mais significatifs et faciles à mémoriser, l'essentiel d'une théorie, d'une doctrine, d'une question scientifique (en particulier médicale, politique, etc.) : "Nous allons démontrer, par les propres aphorismes de l'économie politique et du droit, c'est-à-dire par tout ce que la propriété peut objecter de plus spécieux : 1) que le travail n'a par lui-même, sur les choses de la nature, aucune puissance d'appropriation; (PROUDHON)
ListeDeMurs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** mur du çon franchi par...
* murs de [Jericho|http://www.paroles.net/chansons/17039.htm]
* murs ont la [parole|http://www.increvablesanarchistes.org/album_photo/phot1968/phot68_murs.htm]
* Le Mur des fédèrés (cimetière du Père Lachaise à Paris)
* Le Mur des Déportés (Paris 2005)
* Le Mur du silence (Chez monsieur et madame Durand, quelque part en France)
* Le Mur Végétal du Quai Branly (Paris)
* Le Mur de la Paix (Paris)
ListeDeTroisPetitsChats
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Tout le monde connait ce jeu. Non? C'est simple, il faut écrire un mot ou un groupe de mot de trois syllabes à l'oral qui commence par la dernière syllabe du mot précédent. Attention, il ne faut pas répéter la même chose. Vous êtes prêts? C'est parti.
# J'veux la lune (un peu tiré par ...le n° 81)
## µen espagnol le ''B'' et ''V'' se prononcent quasiment pareil. Et comme il fait soif...µ
## µLà on pourrait partir sur "gueule de loup" et la boucle est bouclée...µ
## µBon, mettons ''Samos'' (pour son muscat) et n'en parlons plus...µ
# Rave party
# Partition
# Agnelet - µobjection, c'est déjà apparue en item 136 !µ
# Montparnasse
# Chambre à part
# Particule
# Revenant µµ(si vous connaissez un mot commen&ccedil;ant par "reu"...)µµ
* En %%Red(rouge)%% les termes tabous sur Echolalie et généralement censurés assez rapidement par la Section Locale de la pureté linguistique
## Par contre, la règle des 3 syllabes n'est pas toujours respectée. Ex. "son et lumière", "coiffeur pour chiens", "L'être et l'néant", le plus foireux étant "y est pas venu", quand on pouvait mettre "yesterday" ou "hiératique"...
Jeu interactif lancé par El Jj (que de la triche)
ListeDeruesquinexistentpas
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Impasse Parissi
* Allée Laid-Pety (µµMais une "Allée les petits" existe au Parc des Princes, en hommage à Roger Couderc)µµ -- on sait ... mais c'est pour dire ... holala celui-là !!! Faut toujours qu'il étale son savoir ... pénible !
**µErreur, elle existe, notamment à Paris (XIIe)µ
ListeDeCourrierRecuPendantUnVoyageEnOrient
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeJeudis
/* par PITIE ne mettez pas de liens vers de GROS jeudis. Merci
* jeudi 18 décembre 2003, à 20 h : François Le Lionnais, encyclopédisparate
* jeudi 12 février 2004, à 20 h : Secrets (plus ou moins) partagés
* jeudi 25 mars 2004, à 20 h : Journée sans télé, émission animé par Fabrice
* jeudi 22 avril 2004, à 20 h : Souvenirs de [la fin du monde|ListeDeFinsDuMonde] par différents prophètes
* jeudi 17 juin 2004, à 20 h : Une nuit sur l'Acropole ou Ma nuit sur le mont chauve par Elodie Chérie
* jeudi 24 juin 2004, à 20 h : [L'appel du 18 juin par le Général de Gaulle|ListedAppels] Rediffusion
* jeudi 21 octobre 2004, à 20 h : Suppositoires à l'eucalyptus ou suppositoires à la glycérine ? : Un [débat animé par un dignitaire de la secte des compagnons de l'anus|ListeDesDignitairesDeLaSecteDesCompagnonsDelAnus]
* jeudi 28 octobre 2004, à 20 h : De l'utilité du [portemanteau|ListeDeCeQuonPeutFaireAvecUnPorteManteau], causerie par le professeur Cintré.
* jeudi 2 décembre 2004, à 20 h : Variété, Johnny Hallyday chante "souvenirs, souvenirs" accompagné par le Philharmonique de Berlin
* jeudi 16 décembre 2004, à 20 h : [Les animaux ont-ils un langage|ListedAnimauxQuiParlentDansLesBandesDessinees] avec la participation de Gilles Matou et de Sébastien Cheval.
* jeudi 30 décembre 2004, à 20 h : La langouste ne passera pas, émission présenté par Omar.
* Jeudi 20 janvier 2005, à 20 heures : A l'occasion du 160ème anniversaire de la naissance d'Ernest Chausson, débat sur les charentaises, avec la participation d'un membre du conseil général de la Charente, d'une charentaise en retraite et d'une vendeuse de chaussures.
* Jeudi 3 février 2005, à 20 heures : Il y a 154 ans (le 3 février 1851) furent instaurés les bateaux-lavoirs de Paris. Les lavandières étant réputées de mœurs légères, nombreux étaient les hommes en quête d’aventures et venant troubler leur travail le long des cours d’eau. Pour enrayer cette situation, on dut créer des endroits où elles pourraient laver en toute tranquillité. Où en est-on aujourd'hui ? Débat avec une lavandière de mœurs légères et un homme en quête d'aventure.
* Jeudi 17 février 2005, à 20 h : L'émission avec Paris Hilton qui fête aujourd'hui ses 24 ans a été annulée par la direction, jugeant le sujet pas assez culturel. Ce programme sera remplacé par un concert de la musique des gardiens de la paix dirigée par Désirée Dondaine.[http://www.megamonalisa.com/artworks/megamonalisa_paris-hilton.jpg]
* Jeudi 24 février 2005, à 20 h : Débat sur la fidélité avec la participation de Monseigneur Lustiger, évêque de Paris, de Cathy Millet, romancière et de l'amant de Lady Chatterley.
* Jeudi 17 mars 2005, à 20 h : à l'occasion du 95ème anniversaire de l'instauration d'un sens giratoire place de la Concorde, il est temps d'en dresser le bilan. Avec la participation de Bison futé, du préfet de police et d'une contractuelle.
* jeudi 14 avril 2005, à 20 h : "si on parlait d'autre choses" émission présentée par Laure Sainclair !
* jeudi 5 mai 2005, à 20 h : diffusion de l'émission prévue le 21 avril, le nouveau pape n'ayant pas choisi le nom prévu par notre ordinateur
* jeudi 12 mai 2005, à 20 h : débat sur l'[inutilité|ListeDeTrucsCompletementsInutiles] avec la participation de trois personnes inutiles
* jeudi 26 mai 2005, à 20 h : "La grenouille sur le nénuphar respecte-t-elle la liberté du nénuphar ?" Débat avec la participation de Kermit la grenouille [http://www.ezthemes.com/previews/k/kermit.jpg]
La candidature de Paris aux [Jeux Olympiques|ListePourFaireDesPropositionsDeDisciplinesNouvellesAuxProchainsJeuxOlympiques] était-elle judicieuse ?
* jeudi 15 septembre 2005 à 20 heures : par suite d'une interruption de trav...
* jeudi 3 novembre 2005 à 20 heures : Enquête sur les polochons avec la participation de Paul Hochon et des professionnels de la profession
* jeudi 17 novembre 2005 à 20 heures : Dénoncez votre voisine ! Jeux animé par Roch Voisine
* jeudi 29 décembre 2005 à 20 heures : en léger différé du Vatican, bénédiction urbi et orbi par Sa Sainteté le Pape @@Jean-Paul II@@ Benoît 16
* jeudi 5 janvier 2006 à 20 heures : Sachez découper la galette des rois avec la participation du club des sans culottes du Kremlin Bicêtre
* jeudi 12 janvier 2006 à 20 heures : Quand le cerveau nous joue des tours avec la participation du grand Gogol
* jeudi 19 janvier 2006 à 20 heures : "Associer le scoubidou aux pommes et aux poires est une aberration sémantique". Causerie par Alain Rey [http://marjorie-art.voila.net/scoubidou.jpg]
* jeudi 26 janvier 2006 à 20 heures : Rediffusion de l'émission du 19 janvier parce que c'était un peu compliqué
* jeudi 2 février 2006 à 20 heures : Voyage en OVNI et besoins naturels. Avec la participation de Raël
* jeudi 9 février 2006 à 20 heures : Les dernières nouvelles de demain par Geneviève Tabouis.
* jeudi 9 juin 2006 à 20 heures : Nouvelle rediffusion de l'émission du 19 janvier parce que c'était un peu compliqué
* jeudi 16 juin 2006 à 20 heures : Darladadila dada, reportage sur le milieu des courses hippiques avec la participation du facteur Cheval
* jeudi 29 juin 2006 à 20 heures : Demain c'est les vacances, débat avec la participation de Mr Hulot
* jeudi 6 juillet 2006 à 20 heures : Mais savez-vous danser le tango, émission sponsorisé par Tanga
* jeudi 20 juillet 2006 à 20 heures : Grève spontanée des techniciens de surface, entraînant par solidarité celles des intermittents du spectacle refusant de travailler dans un bordel pareil, donc pas d'émission ce jeudi-là !
* jeudi 7 septembre 2006 à 20 heures : Organisez une petite orgie sympa chez vous, avec la participation du "club m'aide"
* jeudi 21 septembre 2006 à 20 heures : G. a perdu sa clarinette, aidez le à la retrouver. Divertissement proposé par l'association des gardes champêtre du Lot
* jeudi 12 octobre 2006 à 20 heures : "Les 35 heures c'est pas bien" causerie par le club des libéraux.
* jeudi 9 novembre 2006 à 20 heures : @@Match de catch à 12@@ déprogrammé remplacé par "Interlude in the tube"
* jeudi 30 novembre 2006 à 20 heures : C'est bientôt Noël, débat sur les fêtes de fin d'année avec la participation de la mère Noël
* jeudi 14 décembre 2006 à 20 heures : "Si Pinochet a regretté ses fautes avant de mourir ira-t-il au paradis, ou devra-t-il passer par le purgatoire ? Débat avec un curé de campagne et des représentants de la fraternité Sein Pie X.
* jeudi 18 janvier 2007 à 20 heures : débat sur la [bravitude|ListeDeBravitude] (il paraît qu'il y en a que ça intéresse...)
* jeudi 25 janvier 2007 à 20 heures : débat sur le godivisme avec Lady Godiva, Mireille Darc et Paris Hilton
* jeudi 1 février 2007 à 20 heures : Débat "quand arrêta-t-on de nous prendre pour des cons ?" avec la participation d'un panel de cons.
* jeudi 1er mars 2007 à 20 heures : La sexualité des marsupiaux, avec la participation de deux couples de kangourous.
* jeudi 5 avril 2007 à 20 heures : "La coccinelle souffre-t-elle du syndrome de la tortue" avec la participation de Brigitte Bardot
* jeudi 2 mai 2007 à 20 heures : "Conservez votre muguet d'hier !" Causerie herboriste par Jean-Pascal Labéssoury.[http://lemomo2.pagesperso-orange.fr/Surf/Muguet.jpg]
* jeudi 16 mai 2007 à 20 heures : "Que faire en cas de chute de météorite ?" Emission sponsorisée par les parapluies "Rossignol"
* jeudi 23 mai 2007 à 20 heures : "Préparez vos vacances sans avoir des valises sous les yeux". Emission sponsorisée par le ministère du tourisme
* jeudi 30 mai 2007 à 20 heures : "Qu'avez-vous fait de votre moi de mai" Causerie de l'archevêque de Paris.
* jeudi 13 juin 2007 à 20 heures : "Sortir en juin sans son pépin, c'est pas très malin". Emission sponsorisée par les parapluies "Rossignol"
* jeudi 27 juin 2007 à 20 heures : "Préparez le feu de la Saint-Jean !" Emission sponsorisée par la Société d'exploitation des tabacs et allumettes.
* jeudi 25 juillet 2007 à 20 heures : "La vérité sur les templiers" avec la participation d'un templier.
* jeudi 1er août à 20 heures : "Bien prononcer le mot "août"" avec la participation du professeur Pomerol, orthophoniste agrée.
* jeudi 8 août 2007 à 20 heures : "Trouver un plombier en Août, oui c'est possible !" émission produite par la télévision polonaise.
* jeudi 15 août 2007 à 20 heures : "La mi-août c'est la fête des chats !" Avec la participation de Geluck
* jeudi 23 août 2007 à 20 heures : "Ça sent la fin des vacances !" Emission sur les odeurs avec la participation de Madame Coco Chanel
* jeudi 30 août 2007 à 20 heures : "Et si on reparlait du tour de France ? " avec Bernadino.
* jeudi 6 septembre 2007 à 20 heures : "La rentrée des classes : comment récupérer votre gamin intact à la sortie de l'école ?" Avec la participation du ministre de l'intérieur
* jeudi 27 septembre 2007 à 20 heures : "Les sanglots long des violons de l'automne" avec la participation d'un violoniste de l'Orchestre de l'Opéra de Paris
* jeudi 1er novembre 2007 à 20 heures : En raison des fêtes de la toussaint, l'émission sera remplacée par une causerie de Monsieur André 23, pape de Paris, des environs et autre lieux.
* jeudi 8 novembre 2007 à 20 heures : Profitons des trains qui roulent, émission sponsorisée par la Vie Duraille.
* jeudi 6 décembre 2007 à 20 heures : En raison de la Saint Nicolas, le président de la république, rompra avec ses habitudes en faisant une apparition à la télévision. Il n'y aura donc pas d'émission ce jour-là.
* jeudi 13 décembre 2007 à 20 heures : L'alibi de la Lybie, avec la participation de Blake et Mortimer.
* jeudi 4 janvier 2008 à 20 heures : Photos de vacances en Egypte avec la participation de @@Ramsès I@@I Monsieur Nicolas S.
* jeudi 11 janvier 2008 à 20 heures : Il paraît que Carla Bruni, reportage sur les méfaits des produits autobronzants
* jeudi 18 janvier 2008 à 20 heures : Notre émission est particulièrement fière de donner la parole à des gens qui ne peuvent jamais s'exprimer. Ce soir Monsieur Benoit XVI, empêché de parler à l'université de Rome.
* jeudi 8 février 2008 à 20 heures : Apprenez à faire le trader, avec la participation de Jérôme Kerviel - µ''Kerviel étant en tôle, il sera remplacé par Michel Galabru qui tiendra son rôle''µ
* jeudi 29 février 2008 à 20 heures : Les 29 février c'est tous les 4 ans, mais les jeudi 29 février c'est tous les 28 ans. Tous les détails de cette sombre histoire vous seront expliqués par les frères Igor et Grichka Bogdanov.
* jeudi 17 avril 2008 à 20 heures : Il y a 1 chance contre 450 que la fin du monde ait lieu en 2036. Comment se préparer ? Participation d'un antipape et de quelques soupapes.
* jeudi 8 mai 2008 à 20 heures : Encore un pont... Enquête sur un projet architectural parisien qui n'a jamais vu le jour : Le Pont Pidou.
* jeudi 15 mai 2008 à 20 heures : Le Paris-Saint-Germain se maintiendra-t-il en Ligue 1 ? Débat avec la participation d'un supporter typique et un arbitre corruptible.
* jeudi 29 mai 2008 à 20 heures : Soirée de l'étrange. Débat avec la participation du monstre du Loch Ness, qui répondra en direct à vos questions.
* jeudi 5 juin 2008 à 20 heures : Qui veut gagner des morpions ? Emission sur les [parasites|ListedeParasites] corporels
* jeudi 12 juin 2008 à 20 heures : ''"Quand la veille du vendredi 13 tombe un jeudi 12, c'est l'Odyssée de la partouze."'' Emission déconseillée aux petits n'enfants.
* jeudi 19 juin 2008 à 20 heures : Enquête sur les nouveaux philatélistes avec la participation d'un passionné qui vous montrera comment lécher les culs des timbres.
* jeudi 26 juin 2008 à 20 heures : C'est la canicule ! Jouez à trouver des [rîmes en ul| ListeDalexandrinsFinissantParLeSonUle].
* jeudi 10 juillet 2008 à 20 heures : J'y vais-t'y ? J'y vais-t'y pas ? Ballet moderne inspiré par les hésitations du président au sujet de sa présence aux JO de Pékin.
* jeudi 17 juillet 2008 à 20 heures : Tour de France : résumé de l'étape par le docteur Pilule.
* jeudi 24 juillet 2008 à 20 heures : Enigme avec la participation des téléspectateurs : Les fils Sarkozy et la fille Darty sont dans un bateau...
* jeudi 21 août 2008 à 20 heures : "Les méchants et les gentils" Débat avec pour les gentils un tibétain et un géorgien, pour les méchants un chinois et un ossète du sud. Sponsorisé par Urgo.
* Jeudi 04 septembre 2008 à 20 heures : La beauté intérieure : Débat avec Laurence Parisot
* Jeudi 11 septembre 2008 à 20 heures : Les trous noirs c'est troublant, débat avec des scientifiques du CERN et la participation d'un trouvère.
* Jeudi 18 septembre 2008 à 20 heures : Emission spéciale de remerciements animée par Ingrid Betancourt avec les participations exceptionnelles de Nicolas Sarkozy, de Benoît XVI et de la Vierge Marie.
* Jeudi 2 octobre 2008 à 20 heures : Les Vamps ! Avec la participation de Christine Lagarde, Arlette Laguiller et Laurence Parisot.
* Jeudi 16 octobre 2008 à 20 heures :"Il avait une jambe de bois" Divertissement avec Guillaume Depardieu
* Jeudi 4 décembre 2008 à 20 heures : "J'en ai marre qu'on me contredise tout le temps". Chronique présentée par Rachida Dati
* Jeudi 1er janvier 2009 à 20 heures : Comment sortir indemne du réveillon, avec la présence de monsieur Tisane, pharmacien en Corrèze. Sponsorisé par Alka-Seltzer™
* Jeudi 8 janvier 2009 à 20 heures : "Fourre la bien !" Divertissement avec la participation de Claudine Frangipane
* Jeudi 15 janvier 2009 à 20 heures : Images de Province : aujourd'hui la vie dans le Berri avec la participation @@de Claude Berri@@ d'un berrichon anonyme
* Jeudi 5 février 2009 à 20 heures : Destruction en direct du premier satellite artificiel iranien, avec la participation amicale de Paco Rabanne.
* Jeudi 12 février 2009 à 20 heures : Remise en direct du prix du meilleur réalisateur de tous les temps à Dany Boon, avec la participation amicale et désintéressée de Dany Boon.
* Jeudi 9 avril 2009 à 20 heures : En application des lois antitabac, le ministère de la santé indique que le jour des cendres sera interdit à partir de l'an prochain. Protestation officielle de l'archevêché et débat avec un non-fumeur.
* Jeudi 23 avril 2009 à 20 heures : "Ce n'est pas parce que 10 000 perroquets répètent la même connerie, que ce n'est pas une connerie". Exposé sur la connerie
* Jeudi 5 juin 2009 à 20 heures : Hommage à David Carradine. Travaux pratiques, comment se faire plaisir tout seul en restant à la maison avec la participation de Godet Michel, sexologue.
* Jeudi 26 juin 2009 à 20 heures : Retransmission en léger différé, du parc Hinson, du championnat individuel de croquitude de tablettes de chocolats (sans les mains) entre Rex et Cécile Flottante.
* Jeudi 3 juillet 2009 à 20 heures : Grand jeu d'été, l'équipe A va s'emparer d'Ingrid Betancourt et l'équipe B va tenter de la libérer.
* Jeudi 30 juillet 2009 à 20 heures : Médecine à deux vitesse : Le professeur Rotule tentera d'expliquer en direct pourquoi Nicolas Sarkozy n'a pas eu besoin de patienter 3 heures aux urgences pour être pris en charge par les services hospitaliers
* Jeudi 13 août 2009 à 20 heures : Les objets du 13 août : Le 13 août vreboite, le 13 août vrebouteille, le 13 août vert, le 13 août zbek, tout cela présenté par le 13 août lipo.
* Jeudi 27 août 2009 à 20 heures : Ted Kennedy a-t-il été assassiné par la Mafia. Débat avec le président de l'association "on nous cache tout, on nous dit rien"
* Jeudi 10 septembre 2009 à 20 heures : Raël nous parle de la fabrication du papier toilette chez les Elohims
* Jeudi 17 septembre 2009 à 20 heures : De l'art ou du cochon ! Débat sur l'érotisme dans l'art avec la participation e Sainte Thérèse de Lisieux
* Jeudi 29 octobre 2009 à 20 heures : Le chauffage central du sauvage central, causerie ethnologique avec la participation de Monsieur Claude Lévi-Strauss, centenaire.
* Jeudi 5 novembre 2009 à 20 heures : Plus que 3 ans avant 2012 – Comment fabriquer un abri dans son jardin ? Et si on n'a pas de jardin ? Toutes ces questions seront abordées par plusieurs nains de jardins.
* Jeudi 26 novembre 2009 à 20 heures : Campagne de vaccination contre les accidents de la route, avec la participation de Monsieur Futé Bison et Madame Bachelot Roselyne.
* Jeudi 29 avril 2010 à 20 heures : Islam et danse du ventre, causerie par Monsieur Frank Ribery, millionnaire et accessoirement footballeur vedette.
* Jeudi 13 mai 2010 à 20 heures : Les apéros géant interdits parce qu'il y a eu un mort, devons-nous alors aussi interdire les routes, les voitures, les lits et les hôpitaux puisqu'on y meurt aussi. Débat avec Roselyne Bachelot
* Jeudi 27 mai 2010 à 20 heures : La mairie de Paris fait retirer les cadenas des amoureux du pont des Art, débat entre un conseiller de Paris interpellé par la sauvegarde du patrimoine et Raoul Vachette, fabricant de cadenas
* Jeudi 10 juin 2010 à 20 heures : Appel à la solidarité de la part des téléspectateurs : Aidez Christine Boutin à s'en sortir !
* Jeudi 24 juin 2010 à 20 heures : Pas d'émission. Remplacé par le match de foot Danemark-Japon en direct de l'Afrique du sud
* Jeudi 1er juillet 2010 à 20 heures : Appel à la solidarité de la part des téléspectateurs : Aidez Eric Woerth à s'en sortir !
* Jeudi 5 août 2010 à 20 heures : Pourquoi y'a des @@travelos@@ travaux partout au mois d'Août ? En direct du Bois de Boulogne.
* Jeudi 12 août 2010 à 20 heures : Quand les journaux n'ont rien à dire pourquoi paraissent-ils ? Chronique amusante du professeur Blumzengut.
* Jeudi 2 septembre 2010 à 20 heures : Les roms, hein ? Débat entre un Rom et un romain (sous réserve de l'expulsion du Rom par le ministère de l'intérieur)
* Jeudi 16 septembre 2010 à 20 heures : "Les gros menteurs sont parmi nous" avec la participation exceptionnelle et exclusive de Sarkozy Nicolas, président de la république.
* Jeudi 30 septembre 2010 à 20 heures : Retransmission en différé de la prise de la Smala d'Abd El-Kader par les troupes du duc d'Aumale, en 1843.
* Jeudi 23 décembre 2010 à 20 heures : Emission pratique, ou trouver encore des dindes, ou trouver encore des chapons. Sponsorisé par les magasins carrefour.
* Jeudi 30 décembre 2010 à 20 heures : Il y a 6 ans jour pour jour disparaissait Artie Shaw, clarinettiste, compositeur, chef d'orchestre de jazz. Soirée d'hommage avec extrait de concert et recettes d'artichauts.[http://marjorie-art.voila.net/713.jpg]
* Jeudi 27 janvier 2011 à 20 heures : Lancement de l'année internationale des forêts décrétée par l'assemblée générale des Nations Unies. Débat avec Marie Laforet.
* Jeudi 17 février 2011 à 20 heures : Moubarak est parti ! Une collecte sera organisée en direct pour lui procurer une valise, un sac à dos, une boussole et des chaussettes de rechange.
* Jeudi 24 mars 2011 à 20 heures : Maitre Capello est mort ! Ce vieux réac défendait la langue française d'une façon figée se rangeant par-là même dans le rang des traditionalistes. Il s'était par exemple opposé à la très timide réforme de l'orthographe proposé par Michel Rocard en 1990. Débat entre un vieux réac et un jeune rapeur.
* Jeudi 31 mars 2011 à 20 heures : Mort de Harry Coover, chimiste américain, inventeur d'un super adhésif, dans l'indifférence générale. Réparons cette injustice car un chimiste qui s'appelle Haricot vert, c'est extra-fin !
* Jeudi 14 avril 2011 à 20 heures : Il y a eu 50 ans hier, jour pour jour, le 12 avril 1961, Youri Gagarine devenait le premier homme à aller dans l'espace. Monsieur Renault en profitera pour nous parler de son automobile Espace.[http://lemomo2.pagesperso-orange.fr/Cosmos/Youri_Gagarine.jpg]
* Jeudi 19 mai 2011 à 20 heures : Par suite d'un arrêt de travail...
* Jeudi 8 septembre 2011 à 20 heures : Il est impossible d'apercevoir la Voie Lactée, la nuit à Paris. Aurait-elle disparue ?
* Jeudi 27 octobre 2011 à 20 heures : La naissance du petit Kadhafi et la mort du Colonel Sarkozy nous ont empêché de suivre le décollage en direct de la fusée papale. En compensation suivez son retour par minou.
* Jeudi 17 novembre 2011 à 20 heures : Monsieur Sarkozy se déplace sous la pluie sans parapluie ! Est-ce bien raisonnable ?
* Jeudi 24 novembre 2011 à 20 heures : Le temps est anormalement doux. Débat avec la participation d'un fabriquant de cidre doux et un n'un doux.
* Jeudi 22 décembre 2011 à 20 heures : A l'occasion du décès de Kim Jong-il, nous aurons le plaisir d'offrir une boite de Kleenex à Messieurs Bachar el-Assad de la Syrie) et Monsieur Hugo Chavez (du Venezuela) qui ont beaucoup pleuré le cher disparu.
* Jeudi 3 janvier 2012 à 20 heures : Nous remercions l'amicale des téléspectateurs des Jeudis de nous avoir offert une galette des rois géante ! Par contre y placer une roue de vélo en tant que fève n'était sans doute pas une très bonne idée.
* Jeudi 17 janvier 2012 à 20 heures : Si ça se trouve dans 6 mois on n'entendra plus parler de Nicolas Sarkozy ! Comment vaincre ce vide existentiel ? Débat avec des psychologues, des sociologues et des montreurs de marionnettes.
* Jeudi 9 février 2012 à 20 heures : Sarkozy sera-t-il candidat, le suspense est insoutenable ! (Emission sponsorisé par les soutien-gorge "Miracle", les soutien-gorge qui soutienne même l'insoutenable !
* Jeudi 15 mars 2012 à 20 heures : A l'occasion de la fête du canard à Cardaillac, une causerie sera animé par Joseph-Ferdinand Caneton afin de faire la promotion de ce sympathique quadrupède.[http://4.bp.blogspot.com/_iTA7ANM6BDY/SQTuCrhPiQI/AAAAAAAAAR0/GoMpqDbhgm4/s200/sex-toy%2Bcanard%2Bsm.jpg]
* Jeudi 22 mars 2012 à 20 heures : Il est impossible de capturer un homme armé vivant. Cours de stratégie policière par différents responsables de la police.
* Jeudi 19 avril 2012 à 20 heures : Il y a 7 ans, Benoît XVI était élu pape, nos félicitations ainsi qu'à son épouse et à ses nombreux enfants et petits-enfants. Chronique : Dans le secret de la papamobile par l'abbé Khane.
* Jeudi 21 juin 2012 à 20 heures : C'est la fête de la musique et l'occasion de se souvenir de la célèbre phrase prononcée à cet occasion par Jack Lang : "Je souhaite que les français descendent dans la rue avec leur instrument à la main."
* Jeudi 19 juillet 2012 à 20 heures : Roger Garaudy vient de casser sa pipe (98 ans), tout le monde l'a oublié, il faut dire qu'il avait fait fort, stalinien, puis islamiste, puis négationniste... Organisation d'une partie de chamboule tout en direct avec des effigies de staliniens, d'islamistes et de négationnistes.
* Jeudi 16 août 2012 à 20 heures : Le 16 août 1977 disparaissait Elvis Presley (overdose de beurre de cacahouètes). Mais est-il bien mort ? Débat avec les fantômes de Dalida et de Claude François.
* Jeudi 30 août 2012 à 20 heures : La comédienne Maggy Dussauchoy, qui incarnait l'exigeante Germaine face aux extraterrestres dans les publicités des pâtes Lustucru, est décédée. Hommage avec un débat auquel participeront le père Lustucru et la mère Michel.[http://lassilia.voila.net/Bonus/Germaine_Lustucru.jpg]
* Jeudi 6 septembre 2012 à 20 heures : Il y a 3 ans, jour pour jour disparaissait Sim, auteur de cette inoubliable citation "Avant de se foutre par la fenêtre, il faut penser à l'ouvrir." hommage et débat entre un fabricant de fenêtre (triple vitrage) et un représentant de Microsoft France (parce que Window, ça signifie fenêtre !)
* Jeudi 20 septembre 2012 à 20 heures : Il y a 89 ans disparaissait Engelbert Humperdinck, débat avec Hänsel, Gretel et un fabriquant de pain d'épices.
* Jeudi 27 septembre 2012 à 20 heures : le scoop du siècle : Paraîtrait qu'il y aurait des matchs truqués dans le sport professionnel ! Où est la vérité ? Qui veut salir le sport avec ses grosses pattes toutes sales ? Débat entre un boxeur en retraite et un faux unijambiste revenant des jeux paralympiques.
* Jeudi 4 octobre 2012 à 20 heures : A l'occasion de la journée mondiale des animaux, retransmission de la première émission de téléchat créée en 1983. En présence chat du Groucha de l'autruche Lola et avec la participation de Micmac le micro vivant. [http://nikosolo.voila.net/images/Groucha_et_Lola.jpg]
* Jeudi 18 octobre 2012 à 20 heures : Sylvia Kristel, vient de mourir, nous sommes tout triste, l’émission est annulée et remplacé par la projection du film Emmanuelle.
* Jeudi 15 novembre 2012 à 20 heures : Il y a 1447 ans (comme le temps passe !) disparaissait Maclou préli-préla de l'église catholique, mort d'une indigestion de flageolets et sanctifié par l'église sous le nom de Saint-Maclou. Il est le saint patron des vendeurs et des poseurs de moquettes. Débat entre un fumeur de moquette et un grossiste en flageolet.
* Jeudi 22 novembre 2012 à 20 heures : Vivez en direct à partir de 20 heures le spectacle de l'explosion de l'U.M.P., l'Union des Minables Politiciens.
* Jeudi 29 novembre 2012 à 20 heures : Jacques Chirac a 80 ans aujourd'hui. La production est heureuse de lui offrir un pack de Corona et une tête de veau sauce bibiche. Réaction de Jacquot en direct (enfin on espère, sinon l'émission sera remplacée par "Le chanteur de Mexico" avec Luis Mariano)
* Jeudi 3 janvier 2013 à 20 heures : Après 2012, année de la partouze, voici 2013, l'année de la baise ! Sommes nous envahi par le sexe ? Débat entre différents religieux de différentes religions.
* Jeudi 10 janvier 2013 à 20 heures : le 10 janvier 1870, Victor Noir était assassiné par Pierre-Napoléon Bonaparte. Depuis son gisant au Père Lachaise est tripoté journellement au niveau de la braguette par des femmes de tout âge. Reportage exclusif.[http://lassilia.voila.net/Image_dico/victornoir.jpg]
* Jeudi 21 février 2013 à 20 heures : En 2005 le pape Jean Paul II refusait de démissionner malgré sa déchéance physique, le monde entier saluait son courage. En 2013, le pape Benoît XVI démissionne (officiellement parce que trop vieux) et le monde entier salue son courage. Quoique fasse un pape il sera donc toujours très courageux, l'abbé Névole nous expliquera qu'il s’agit là d'un des nouveaux mystères de l'Eglise.
* Jeudi 7 mars 2013 à 20 heures : L’irrésistible comique Hugo Chavez ayant rendu son dernier soupir, nous souhaitions inviter quelques un de ses amis pour faire une émission, mais quand on a vu la liste, nous avons renoncé. Diffusion de Ubu roi, adaptation télévisée intégrale de la pièce d'Alfred Jarry par Jean-Christophe Averty (1965), réédité en DVD par Universal en 2007
* Jeudi 14 mars 2013 à 20 heures : Nous n'avons pas obtenu la permission de diffuser la cérémonie de vérification de la masculinité du nouveau pape qui devait se terminer par la proclamation rituelle "Duos habet et bene pendentes " ("il en a deux, et bien pendantes"). Nous cacherait-on quelque chose. Reportage et documentaire sur les chaises percées.
* Jeudi 18 avril 2013 à 20 heures : Le 18 avril 1161, décédait Thibaut du Bec, Archevêque de Canterbury. Vous ne savez pas qui c'est, nous non plus, pourtant avec un nom pareil, il aurait du passer à la postérité, ben même pas. Chronique de Luc Ferry, "la postérité n'est plus ce qu'elle était, papa !"
* Jeudi 25 avril 2013 à 20 heures : Le 25 avril 1566 disparaissait la poétesse libertine et courtisane [Louise Labé|ListeDeFemmesIntrigantes] dite la Belle Cordière dont il est de bon ton de dire aujourd'hui qu'elle n'exista point, mais cela ne nous empêche pas de nous délecter de ses poèmes, ce qu nous ferons.
* Jeudi 2 mai 2013 à 20 heures : Le 2 mai 1857 disparaissait Alfred de Musset. Nous nous intéresserons à sa littérature grivoise et à ses échanges épistolaires enflammés avec [Georges Sand|http://marjorie-art.voila.net/Sand_Musset.htm], aussi l’émission serait-elle réservée ce soir aux adultes avertis.
* Jeudi 30 mai 2013 à 20 heures : Exécution de Jeanne d'Arc, atteinte de de délires chroniques de l'imagination, compagnon de route du multi-criminel Gilles de Rais et ennemie déclarée des filles de joie. Déclaré sainte par le pape Benoît XV en 1920 rien que pour embêter les partis laïques français. Diffusion du film de Luc Besson avec Mila Jovovich.
* Jeudi 8 août 2013 à 20 heures : Le 1er août 1949, le Bhoutan proclamait son indépendance dans la liesse générale, un an plus tard le Boukistan proclamait son indépendance mais sans être reconnu par la communauté internationale. Débat entre un Bhoutanais et un Boukistanbien.
* Jeudi 19 septembre 2013 à 20 heures : le 19 septembre 305 (ça ne nous rajeunit pas) fut décapité Saint Janvier à Naples sur ordre de la Mafia. Ces dernières paroles durent : "45 rue Pauliveau". Il avait confondu le bourreau et le chauffeur de taxi. Débat en un chauffeur de taxi et un bourreau des chœurs.
* Jeudi 3 octobre 2013 à 20 heures : le 3 septembre 1975 disparaissait Guy Mollet, l'inventeur de l’œuf Mollet. Débat entre Jean-Emile Brouillé et Louis-Ferdinand Coquille.
* Jeudi 17 octobre 2013 à 20 heures : Le temps passe vite, il y a un an déjà disparaissait Sylvia Kristel. On ne profitera pour regarder de nouveau Emmanuelle.
* Jeudi 7 novembre 2013 à 20 heures : le 7 novembre 1983 disparaissait Germaine Tailleferre qui réussit l'exploit posthume d’être citée dans toutes les histoires de la musique mais dont personne n'a jamais entendu sa musique. Débat sur le thème "Les inconnus célèbres".
* Jeudi 14 novembre 2013 à 20 heures : Le 14 novembre 1316 naissait Jean 1er le posthume qui décéda 4 jours plus tard. Il est à l'origine de l'expression "z'aurez 4 jours" qui constitue un exemple d'ordre avec quasi-suppression du sujet, qui se rapproche de l'impératif bien qu'il ne soit pas au présent. Explications détaillées par le professeur Grévissovich.
* Jeudi 28 novembre 2013 à 20 heures : A l'occasion de la grande fête des naturistes d'automne, débat entre un partisan et un adversaire de la Tounuthérapie. Suivi de la projection du film, Mon curé chez les nudistes (avec Paul Préboist)
* Jeudi 19 décembre 2013 à 20 heures : le 19 décembre 1915 disparaissait Aloïs Alzheimer (dit Aloïsus Alzheimer), quelqu’un s'en souvient ? Allô ? Allô ! Non mais allô quoi !
* Jeudi 2 janvier 2014 à 20 heures : le 2 janvier 1860 : annonce à l'Académie des Sciences par Urbain Le Verrier de la découverte d'une nouvelle planète, Vulcain, par l'astronome amateur Edmond Modeste Lescarbault. Or cette planète prtendument située entre Mercure et le Soleil n'existe pas. "Tout le monde peut se tromper", tel sera l'objet du débat de ce soir.
* Jeudi 9 janvier 2014 à 20 heures : le 9 janvier 1626 naissait Armand Jean Le Bouthillier de Rancé. Qui c'est celui-ci ? Et bien c'est l'un des précurseurs de l'Ordre cistercien de la stricte observance ! Vous vous en foutez ! D'accord ! Alors nous diffuserons "Les moines de Saint Bernardins par Ray Ventura et d'autres chansons du même tonneau..
* Jeudi 23 janvier 2014 à 20 heures : Il ya juste 10 ans, la sonde européenne Mars Express apportait la preuve qu'il y a de l'eau sous forme de glace sur la planète Mars. En revanche on n'a pas trouvé de pinard ! Seconde partie du débat entamé jeudi dernier.
* Jeudi 7 février 2014 à 20 heures : Il paraît qu'aujourd'hui c'est la "Journée mondiale sans [téléphone portable| ListeEvolutiveDesFonctionsDuTelephonePortable]" ! vous vous êtes rendu compte de quelque chose, vous ? Débat autour des journées mondiales à la con.
* Jeudi 13 février 2014 à 20 heures : Le 13 février 1021 le calife le plus controversé de l'Égypte fâtimide, Al-Hakim bi-Amr Allah, disparaissait au cours d'une promenade nocturne dans les collines de Al-Muqattam. Le standard sera ouvert, si quelqu'un à des nouvelles, qu'il nous contacte d'urgence.
* Jeudi 27 février 2014 à 20 heures : le 27 février 1933 le Reichstag prenait feu. Soirée spéciale : Que faire en cas d'incendie ? Avec la participation de la Brigade des Sapeurs pompiers.
* Jeudi 17 avril 2014 à 20 heures : Le 17 avril 1161 mourrait Thibaut du Bec, Archevêque de Cantorbéry. Débat : Qu'est ce que ça fait d'avoir un nom idiot avec la participation de Messieurs Godet Michel et Jean-Jacques Roussette
µ''Communiqué par'' l' __Oulipo__ . Auditorium 'Images' - Forum des Halles - Paris - arrangé par zonzon ''(il s'est déchaîné, zonzon !)'' puis complété par Toutunchacun.µ
ListeDeLamas
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Liste lancée par El Jj
ListeDeBoulettes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** ''Rassembler ce qui est épars afin d'élever l'art de l'amalgame culinaire au niveau des sciences exactes''
* Les __délicieuses__ boulettes que prépare Adèle à chaque A.G. pour accompagner le __délicieux__ couscous
ListeDeVousConnaissezLhistoireDe
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeMotsEgrenes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(''__Liste des mots égrenés par Camille Laurens dans ses chroniques "Le grain des mots" de 2001 à 2003__'')%%
ListeDeJeSuis
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Je suis __celui qui a perdu 26 parties d'affilée à Heroes__. (à propos de [Vince|ListeDeVariationsSurVincEstUnLoser], rumeur internet)
* Je suis __celui qui pourchasse le visage des apparences__. ''Milarépa''
* Je suis un __crible__ et votre peu de cervelle sèche parmi mes rayons expirés. ''René Char''
* Je suis l'__dauphin__ d'la Place Dauphine (Paris s'éveille, Dutronc/Lanzmann)
* Yo soy el __desaparecido__. ''Manu Chao''
** µIl me semble que les paroles exactes soient "Me dicen el desaparecido". Si je me trompe veuillez m'excuser. Je suis votre très humble serviteur (Iris).µ
* Je suis __Francis Jammes__ et Je vais au paradis. ''Jammes''
* Je suis le __gardien du sommeil de ses nuits__ ''[Francis Cabrel|http://www.paroles.net/chansons/16594.htm]''
* Je suis un __homme__. - [Michel Polnareff|http://www.paroles.net/chansons/16849.htm]
* Je suis l'__homme à la tête de chou__, moitié légume moitié mec %%%Serge Gainsbourg ''[L'homme à la tête de chou|http://www.paroles.net/chansons/15705.htm]''
* Je suis l'__homme d'un seul amour__, mais je n'sais pas de quel amour - [Michel Sardou|http://www.paroles.net/chansons/16824.htm]
* Je ne suis pas un numéro, je suis un __homme libre__ !%%%(I'm not a number, I'm a free man !) /* restore à partir de vieille sauvegarde, ou ménage à l'occasion d'un classement alpha ? Celle-ci y était à une époque.
* Je suis l'__homme médiatique__ - ''Noir Désir [L'homme pressé|http://www.paroles.net/chansons/15734.htm]''
* Je suis le__mot__ et mon nom n'est jamais parlé. ''Ph. K. Dick''
* Je suis l'__ombre sur la mesure__ ''[La Rumeur|http://www.lexode.com/keskidi/paroles-30356.html]''
* Je suis un __pâle enfant du vieux Paris__... (Intimités). ''François COPPEE''
* Je suis le __parfum__ vivant et défunt. ''Valéry''
* Je suis le __Pauvre Navire__ qui court démâté parmi la tempête. ''Verlaine''
* Je suis le __piéton de la grand'route__ par les bois nains; la rumeur des écluses couvre mes pas. ''Rimbaud''
* Je ne suis que __refuge__ à tout ce que je ne vis pas de vous. ''Philippe Léotard [Danse du grand Wanapi|http://paroles-de-chansons.abazada.com/francaises/34825@lyrics.htm]''
* Je suis le __roi des convertis__ - ''Jacques Dutronc [L'opportuniste|http://www.paroles.net/texte/19431/artis/1461]''
* ''Je suis un __saumon__'', de et par Philippe Avron
* Je suis le__ténébreux__ par qui tout dégénère. ''Hugo''
* Je suis le __ténébreux__, le veuf, l'inconsolé. ''Nerval'' µvoir [ici|http://www.radiofrance.fr/parvis/zjesuis.htm]µ
* Je suis toujours __celui qui t'a aimé__%%%Qui t'embrassait et te faisait pleurer - ''C. Jérôme - [Jérôme c'est moi|http://www.paroles.net/chansons/17041.htm]''
* Je suis __tout__ parce que, en réalité, Je ne suis plus rien. ''Bernhard''
Ne conviennent pas parce que ce ne sont pas des définitions.
* Je suis __si triste__, le coeur noué par la tristesse. ''3eme oeil''
* Je suis__ née dans le faubourg St Denis__ et je suis restée une vraie gosse de Paris ''Mistinguett''
* Je suis partout
* Je suis [par Nicole Rieu |http://www.musikiwi.com/paroles/nicole-rieu-je,suis,31944.html]
"Top chrono .... De la famille des Carangues, je vis dans la plupart des mers du monde. D'une taille de 45 cms mon corps fusiforme comprimé latéralement et mon pédoncule caudal très fin me permettent de tenir jusqu'à 18 noeuds pendant une heure. De nom latin Trachurus trachurus je suis aussi connu sous le nom de saurel ....Je suis , je suis , je suis ..... " (Julien Lepers) -- heu... un saumon? -- une turbine? -- Vanessa Paradis? -- Julien Saurel?
µListe recueillie avec précaution chez des Oulipiens %%Blue((en bleu))%% et continuée par des Echolaliens/ennesµ
%%Red(On peut pas se mélanger avec les Oulipiens ?!!! Et avec les Oulipiennes ?)%% : µla liste bleue a été recueillie sur la liste Oulipo, elle n'était pas destinée à Echolaliste.(A.) Toute liste est destinée, par principe, à Echolalistes. C'est consubstantiel. __Il n'y a pas de liste hors-Echolalistes.(GB)__µ -- µListe reprise [ici|http://www.adele.cafewiki.org/index.php?SuIs]µ
ListedeStandsVisitesauSalonduVin
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(__Liste de stands visités au 25ème [Salon|http://www.linux2.mailclub.fr/sites/vigneron-independant.com/manifestations/desc_salon.php?numsalon=67] des [Caves Particulières|http://www.vigneron-independant.com/]__)%%
** Rouge et blanc, noter le goût particulier du cépage pinot meunier
** Goûter le blanc comme les rouges, par exemple Les Rabasses, blanc 2001
** Tout est bon, par exemple le blanc cuvée d'Estevenas 2001
** Par exemple le viognier
** Par exemple le muscat (pour les dames)
** Pour le goût à rien d'autre pareil des vins du Lyonnais et connexes
* Salon de printemps, du 2 au 5 avril, Porte de Champerret. Donc c'est bon pour les profs de Paris (qui ne seront pas en vacances et par suite libres d'aller s'y arsouiller...)
ListeDePrenomsDeStarsDeLaTeleRealite
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDesSourdsEtMalentendantsCelebres
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Helen __Keller__ (1880-1968), écrivain, activiste et conférencière américaine, son histoire a été adaptée au cinéma dans %%Green(Miracle en Alabama)%% The ''Miracle Worker'' (1962) de Arthur Penn, personnage joué par Patty Duke
* Sarah __Norman__, dans Les %%Green(Enfants du silence)%% ''Children of a Lesser God'', pièce de Mark Medoff, adaptée au cinéma (1986) par Randa Haines, personnage joué par Marlee Matlin au cinéma, Emmanuelle Laborit au théâtre e.a.
* Tryphon __Tournesol__, personnage des %%Green(Aventures de Tintin)%%, par Hergé
* Tommy __Walker__, personnage central du rock opera %%Green(Tommy)%% ''id.'' écrite par Pete Townshend des Who, objet d'une adaptation cinématographique du même titre (1975) par Ken Russell - Tommy est sourd-muet et aveugle, mais c'est psychosomatique
Liste proposée par Pierre le 27 As 131 (Ste Visité) - µDécodeur, plizeµ - µµ http://pata.obspm.fr/publications/calenpat.pdf µµ
ListeDouceDure
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDePiecesRouges
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [salon rouge|http://www.artfrance-paris.com/boncompain/shanghai_artmuseum/musee10.htm]
* "Communiste un jour, communiste toujours", comédie musicale en quinze tableaux coécrite par Georges Ionesco et Marcel Dupoint-Dujour. Créé à l'Opéra de Billancourt le 1er mai 1977.
ListeDeVariantesDeBonneFinDeJournee
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Bonne fin de Paris-Dakar
* Bonne fin de partie de Cluédo
* Bonne fin de partie de Beckett
* Bonne fin de partie de billard
* Bonne fin de partie de Cluédo
* Bonne fin de partie de Monopoly
* Bonne fin de partie de Uno
Liste ajoutée à la liste des listes par El Jj, mais tirée de la [liste d'expressions à la mode|ListeDesExpressionsaLaMode] - µet enrichie ou sabotée par divers contributeurs plus ou moins anonymesµ.
ListeDeChosesIntrouvablesSurEcholalie
/* par PITIE ne mettez pas de liens vers de GROSSES images introuvables. merci
* La liste des papes depuis ''Pierre Ier'' classés par ordre lexicographique
* La liste des records battus ou égalés par Jesse Owen
** ben, et [ça|http://mapage.noos.fr/echolalie/x21.htm] ? Je proteste avec véhémence. Cette liste avait, en son temps, été jugée inacceptable par un Ouaibemestre alors au faîte de sa toute-puissance despotique. O tempora...
* Un buste en bronze de Kitten Natividad par le regretté Phidias
* Un petit traité d'onomastique comparée
* Une comparaison approfondie entre Hergé et le cardinal Feltin
ListeDeMetiersFictifs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**''Elle sonnait à la porte des pratiques dont elle avait la clientèle, en général des familles aisées. On lui ouvrait, elle entrait et, tout de go, on la foutait à poil. Elle-même retirait de bonne grâce sa petite culotte pendant que les dames présentes montraient qui leurs seins, qui leurs dos. La partouze achevée, la couturière s’absorbait dans ses travaux d’aiguilles. On lui donnait cent sous. C’était la belle époque.''[http://pagesperso-orange.fr/lemomo2/couture.jpg]
* [Dom Juan|http://www.paroles.net/chansons/14048.htm]
* Employés µ(certains)µ à la Mairie de Paris
* Pécheur par données
* Procureur du départ
* Réparateur de langue de bois
* Réparateur de moulins avant qu'ils ne soit trop tard
* Scaphandrier cycliste (corps d'élite évoqué par certains réformés)
ListeDeLivresQuiParlentDeJe
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
liste démarrée par chori(So ?)
ListeDeNuages
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
*[Nuages, par Patrick Rondat|http://www.deezer.com/listen-8070374]
%%Center(Tiré par des bœufs, le chariot avançait)%%
%%Center(Je cherchais ses yeux voilés par sa main)%%
%%Center(A travers les dunes elle a disparu)%%
%%Green(- Vous vous servez là d'une parole dont le sens m'est restée jusqu'à ce jour inconnu.)%%
ListeDeGuides
/* par PITIE ne mettez pas de liens vers de GROS guides. merci
* Le guide du parler [Pagolak|http://240plan.ovh.net/~echolali/wiki/index.php?ListeExperimentaleEtSuccinteDuParlerPagOlak]
ListeDesQualitesDuBonFonctionnaire
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Obéissance respectueuse et vertueuse aux Chefs.(par exemple, quand on fait partie des R.G., enquêter pour le compte personnel de nicoculas sarkocuzi)
* Veste réversible, pour parer à toute surprise électorale
* AW allie un sens certain de l'initiative à un doigté tactile pour tout ce qui touche les formulaires. Il nous parait nécessaire et urgent de promouvoir cet agent modèle". (GB)
* ponctuelle, appliquée, et sérieuse, l'ouvrière Sol a toujours rempli ses quotas quotidiens, n'hésitant pas à prolonger ses heures de travail dans les cas urgents (capture de séparatistes basques, etc). Il nous parait nécessaire de récompenser cet élément modèle par une promotion cadre 1A, qui sera publiée au Journal Officiel.
ListeDeTrenteCinqAnnees
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# Partie de Go à Zagora et dans le Limousin
ListeDeMilleNeufCentQuatreVingtDixHuit
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* des parkings...
* __Terminus Paradis__
* '' Eléments moins performants'' (par la Compgnie Brozzoni)
µµ proposé par Choriµµ
ListeDesLieuxCommunsNumerotes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
''(déjà parus)''
# les parenthèses
# le paradis
# des parkings
# paroles et musiques
µµ proposé par Choriµµ
* L'association Echolalie pourra-t-elle être destinataire des prochaines parutions ? (A.)
ListeDeConseilsAuxFemmesPourLaBonneMarcheDesMenages
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(Liste automatique - si ça paraît incompréhensible faite F5)%%
* Parfois nous ne pensons pas à vous. Ce n'est pas %%Queryword(adj+mas+sg,*ave)%%.. C'est comme ça. Ne nous demandez pas à quoi nous pensons si vous ne voulez pas parler de sport, ou de voiture, ou de %%Queryword(nom+mas+sg)%%...
* Quand nous devons aller quelque part, quel que soit le vêtement que vous mettez, il vous ira %%Queryword(adv,*ment)%%... Promis.
* Les réponses simples comme : "OUI %%Queryword(nom,*oui)%% ou NON %%Queryword(nom, *on)%%" sont parfaitement valables quelle que soit la question.
*µJ'ai passé la liste à la moulinette, ça me parait moins %%Queryword(adj+mas+sg,*on)%%.µ
Communiqué par Quentin P.
ListedInscriptionAlAssociation
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
__%%Center(Association µECHOLALIEµ%%%29, rue de l'Ermitage%%%75020 PARIS)%%__
* Article 5 - adhésion : Pour faire partie de l'association, il faut souscrire un bulletin d'adhésion puis : - avoir acquitté un droit d'entrée; - être agréé par le conseil d'administration.
** µCommentaires : il suffit d'être agréé par le conseil courant, sans réunion extraordinaire ni rien. Donc ça va vite. c'est à dire les membres du conseil ils se mailent : ok pour Z? va payer sa cotis ? il nous paye un pot ? ok, bien sur. Il est membre.µ
ListeDeGros
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!Partie automatique
# gros [bisou|ListeDeBaisers], gros %%Queryword(nom+mas,*sous)%% µ(cf ''poutoux'', infra -- expression employé par les gros cuistres)µ
!Partie manuelle
# gros zoom [http://www.wpc-fr.net/images/articles/comparatif-de-gros-zooms-a-petits-prix/zoom.jpg]
µµproposée par chori mais bofµµ
ListeDeTitresDeGlenBaxter
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDesPontsCinematographiques
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Le Rock river bridge dans ''le mécano de la « Général »'' de Keaton, en feu, et qui s'effondre dans la rivière -- plus encore, surtout la tête de l'acteur jouant le commandant yankee et qui n'était pas au courant de ce que Buster préparait !
** Aussi, le pont couvert où les yankees ont caché un wagon en feu ; et le "demi" viaduc sur lequel ils se retrouvent suite à un sabotage de l'aiguillage, avec le pare-buffle et un soldat suspendus au bout au-dessus du vide.
* ListeDePontDeParis (avec une belle faute dans le titre)
ListeDeBouquinsQuiFontRireOuSourire
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeGensTroublants
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Jean-Louis Barrault (dans les enfants du paradis) [http://garance.chez.tiscali.fr/images/baptiste.jpg]
* les acteurs de ''Ken Park''
* Michel Serrault, par exemple dans "Les fantômes du chapelier" (µ''et dans "Mortelle Randonnée", aussi...''µ)
* Dana Andrews (par exemple dans ''Rendez-vous avec la peur'')
ListeDeRecettes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**Préparation :
** Ingrédients Pour 4 personnes : Environ 2OO g. de mélange de salades, (frisée, feuilles de chênes, cœur de laitue) huile d’olive, vinaigre (balsamique par exemple), 12 tranches de Coppa, 12 tranches de Pancetta, 12 grandes tranches de mortadelle, 4 tomates, 125 g. de Port-Salut™, 100 grammes d’anchois (évitez les anchois en conserve à cause de l’huile), quelques feuilles de menthes.
**Préparation :
****Préparez une vinaigrette avec l’huile d’olive et de vinaigre. Assaisonnez avec la salade, préalablement lavée et égouttée. Coupez les tomates en quartiers. Faire-les revenir à la poêle, environ 5 minutes.. Préparez les assiettes avec un lit de salade sur lequel sont disposées harmonieusement les tranches de charcuterie. Répartir ensuite les anchois, le fromage et les tomates sur chaque assiette. Parsemez de feuilles de menthe.
[http://educ.csmv.qc.ca/mgrparent/vieanimale/ois/flamant/crevette.jpg]
** Cassez délicatement un œuf par dessus, sel, poivre...µ(ça n'explose pas ?)µ
** Puis une bonne cuillère à soupe de votre confiture favorite (''mûres par exemple'')
**Prenez une tasse à café, passez la au robinet, ne l'essuyez pas, saupoudrez de sel les parois de la tasse, et éventuellement de poivre. Cassez l'œuf frais dedans. Rajoutez du Tabasco ®mais sans mélanger. Introduisez tout dans la bouche et déguster... Forme garantie ! [http://membres.lycos.fr/fantoche2/oeufs-casses2.gif]
**Préparez un café au lait abondement sucré, servez dans un bol. Prenez chaque surimi et trempez-le abondamment dans le bol. On peut aussi préalablement enduire le surimi de moutarde, de mayonnaise ou de ketchup.
**Préparation
**Eh hop, 5 berres de plus. Ca fait du bien par où que ça passe.
**Essayer de sortir le bour de cette saloberie de brinde de nouveau parce gue za a loupé la bremiere vois.
%%Red((1))%% : Comment fait-on pour mélanger des coquillettes froides qui font ''bloc'' ? -- %%Blue((2))%% On les sépare ''amoureusement'' à la fourchette, auparavant (''ou même avec les doigts!!!'')
ListeDeTrucsQuimEnervent
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Les gens qui se croient obligés d'acheter une bande dessinée parce ce qu'il y en a des piles à la FNAC
**** moi, c'est les Gaston Lagaffe, t'es pardonné.
** pareil pour les Asterix quand Uderzo a commencé à faire les "textes"
* les livres mouillés par accident
** µA propos, vous qui paraissez au jus, qui a gagné ?µ
ListeDeLoisEtrangesDansCertainsPaysConcernantLeSexe
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* À Bahrein, un médecin peut légalement examiner les parties génitales des femmes, mais il lui est interdit de regarder sa patiente pendant l'examen. Il ne peut regarder qu'au travers d'un miroir. µµ- miroir sans tain, alors?µµ
* Les musulmans ne peuvent pas regarder les parties génitales d'un cadavre... même les employés des pompes funèbres... Les organes sexuels des défunts doivent être couvert d'une tuile ou d'un morceau de bois.
* À Hong Kong, une femme trahie peut légalement tuer son mari adultère, mais uniquement de ses propres mains. En contrepartie, la femme adultère peut être tuée de n'importe quelle façon par son mari.
* À Tucson (Arizona, USA), il est illégal pour les femmes de porter un pantalon. µµEn France aussi ... -- mais non ! -- Mais si ! -- Le texte d'interdiction est une ordonnance de police du 26 brumaire an VIII (17 novembre 1799), signée par le préfet de police de Paris et jamais abrogé.µµ
* En Arkansas (USA) un homme a le droit de frapper sa femme... une fois par mois.
* Dans l'état de Washington (USA), avoir une relation sexuelle avec un animal est parfaitement légal tant que ce dernier ne pèse pas plus de 40 pounds (environ 18 kilos)
* État du Delaware, USA, il est illégal de se marier suite à un pari.
**µC'est hélas parfaitement exact (ce sont les effets pervers du principe de précaution, mais ça n'a rien à voir avec le sexe !)µ
ListeDePhotosDuJour
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
__ qui passait par là présidence de la République compassé très attentif aux __
ListeDeSectesQuiExistentPeutEtre
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Leur chanson préférée : L'été indien par Joe Dassin
* Les amis des bars parallèles
**''Possedent un bar à Paris - Un bar à eau ! Rendez-vous compte le degré de [perversion|ListeDePerversions] qu'on peut parfois atteindre !)''
** ''Leur repère est rue Hérold à Paris près du siège de la Banque de France... Un bar à soupe... L'horreur ! Ah ! Ah ! Ah ! Ils sont démasqués les tristes sires''
* %%Red(Les Copainch)%% (apparentés aux Amish)
* Le Club français du Vin (''envoient du pinard par la poste !'')
* Les Pado-Padesavons (présidé par sa pestilence le baron Serpillère 1er)
**µµLes vampires existent... Ils n'appartiennent pas seulement aux anciennes légendes de Transylvanie. En France, comme à l'étranger, des sectes étranges pratiquent le culte du vampire, rendant hommage à Vlad Drakul, prince des ténèbres. Elles perpétuent de mystérieux rituels d'alliance avec les puissances de la nuit... De Venise aux montagnes des Carpates, en passant par le château de Dracula, à Cuerta-de-Arges, qui est l'un des hauts lieux du vampirisme contemporain, une sorte de Katmandou de la magie rouge. Aujourd'hui, Dracula vit encore. (car il bande encore) Il est l'anti-Dieu prévu pour la fin des tempsµµ
#µcela dit, ergoter sur ce qui c'est vraiment passé ne sert à rien ni à personne. Il n'est quand même pas compliqué de comprendre que ses proches déjà dans la peine aient choisi une version soft de sa mort. N'importe qui aurait fait pareil. Ce n'est pas de l'hypocrisie, c'est de la décence.µ
µµcrée par le membre 107 de la secte ****µµ
ListeDeFer
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(''On a beau avoir une santé de fer, on finit toujours par rouiller.''Jacques Prévert)%%
ListedOr
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* On trouve de l'or à l'état natif et également dans des minerais de cuivre. L'or est utilisé en joaillerie, pour certaines pièces de monnaie et en électronique. Étant donné qu'il réfléchit bien les infrarouges, on l'utilise sous forme de film très fin sur les vitres des gratte-ciel afin de réduire la chaleur provoquée par le soleil. Le prix de l'or pur à 99.99 %, en grains, est de 1653 ? pour 25 g.
* Le silence est d'or (la parole est d'argent mais - cf infra)
/*%%Center(µµremarquer à droite le fameux [regard|ListeDesMonumentsDeParis ]µµ)%%
* Les pommes d'or µ(des Hespérides, récoltées par le regretté Hercule, ou simplement les tomates)µ
* Le ''tchador'' µ(quoique je déplore et réprouve ce déguisement, j'espère que le mot n'est pas prohibé par la Section Locale de la ''political correctness'' !)µ
Liste commencée par El Jj
ListedAcier
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* André Dacier (1651-1722) ! Homme de lettre. C'était un homme qui connaissait parfaitement le latin et le grec. Il se passionnait pour tout ce qui avait un rapport avec l'Antiquité. Il épousa une femme qui avait exactement les mêmes goûts que lui, et ils ne vécurent plus que pour le grand passé méditerranéen, et cela à tel point qu'ils faillirent un jour s'empoisonner Mme Dacier ayant voulu confectionner un ragoût dont elle avait trouvé la recette dans Athénée. [http://images.evene.fr/img/celeb/1038.jpg]
* Paradisier Gorge d'Acier
%%Image(http://www.oiseaux.net/oiseaux/passeriformes/images/paradisier.gorge-d.acier.rbsh.0g.jpg,300,300)%%
ListeDeSilences
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Mon silence après les paroles cruelles qu'il a prononcées
* ''Silent movie'' (Mel Brooks, 1976) où le seul mot prononcé est "Non !" dit par Marcel Marceau
* le silence est d'or, la parole est d'argent
* Un silence parce que on a rien besoin de se dire, on se comprend avec les yeux µµ(et même les yeux fermés)µµ
ListeMartineMauleon
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** C'est plutôt la révolution qu'induit Internet et les réseaux qui crée de nouveaux emplois. Je vais vous donner un exemple. A Limoges, il y a l'industrie porcelainière depuis des siècles. Et bien un jour, ils se sont dit que pour attaquer le marché japonais par exemple, ou américain, il fallait faire du commerce électronique. Donc ils ont monté une plate-forme de commerce électronique où chacun mettait un catalogue avec ses produits puisqu'il fallait attaquer un gros marché; et depuis qu'ils ont monté ce commerce électronique, depuis un an et demi, 95% de leur fabrication de petites boîtes sont vendus au Japon et aux Etats-Unis. Et ça veut dire que ça; ils ne l'avaient pas ! Avant, ils ne vendaient que 5%.
** Donc ça a créé quoi ? Evidemment, ça a créé un webmaster, évidemment ça a créé quelque part un poste d'infographiste. Mais ça a créé quoi ? Des postes de dames et de messieurs qui font de la décoration sur porcelaine, et donc plein d'emplois dans le monde de la porcelaine, pour le Japon et les USA.
** Sous la direction de Denys AGUETTANT, Les décisions sont prises a l'aide d'un Comité Exécutif, présidé par Pierre LESCURE, qui compte parmi ses membres %%Red(Martine MAULEON)%%, Alain CHABAT, [Jacques NIKONOFF|http://www.france.attac.org/au809], Didier LIVIO...
* 75 % des espèces cultivées il y a un siècle sont aujourd'hui oubliées. Intelligence Verte est le nom choisi par un réseau de particuliers, d'entreprises et de personnalités ( dont Michel Lis, Corinne Lepage, Philippe Desbrosses, %%Red(Martine Mauléon)%%, Pierre Tchernia, Jean-Marie Pelt … ) qui rassemble et propose des actions qui contribuent au maintien de la biodiversité.
* Mais c’est sûrement l’université d’été organisée par le CIEPAD à Viols le fort dans l’Hérault sur le thème : « C’est quoi l’argent ?» les derniers jours d’AOUT 1994 qui marquera le plus le point de départ des Sels en France. Un témoignage est fait sur les LETZ par Richard Knights du Letz de Totnes (Grande Bretagne). Serge Latouche économiste universitaire et directeur du MAUSS (mouvement anti utilitariste en sciences sociales) auteur de la Planète des naufragés, fait une conférence débat. L’idée naît d’enlever le mot « Trade » (commerce) à l’appellation « Local Exchange Trade System » donnant ainsi en français l’appellation SEL, et les ariégeois présents à cette université d’été avec François Terris, Alain Bertrand…décident de démarrer dés l’automne 1994 l’expérience en Ariège. Le département de la Haute Garonne prend la suite avec le Sel 31 qui ne tiendra pas et, au début du printemps 1995 le Sel Cocagne à Toulouse, prenant exemple sur le Sel de l’Ariège, démarre à l’occasion des repas de quartiers sur les quais de la Garonne. Le premier Sel des villes était né grâce au Sel des champs ! (titre de l’Inter sels 1999 à Salvagnac).%%%Le premier reportage télévision est effectué par l’équipe Canal + de %%Red(Martine Mauléon)%% à Cocagne à Toulouse, déclenchant par mimétisme une tempête médiatique. Les Sels se multiplient alors dans toutes les régions de France, certains prenant les statuts de l’association 1901, d’autres restant informels (association de fait) au sein d’un petit groupe d’inter connaissance. Au premier janvier 1997 on dénombre déjà 200 Sels. Les rencontres inter sels de Mirepoix dans l’Aude (1996), puis de Thivier en Dordogne (1997), puis des Vans en Ardèche (1998), puis de Salvagnac dans le Tarn (1999), puis de Caen en Normandie (2000) jalonneront comme autant de points de rencontre et de débats (charte) la lente maturation du mouvement des Sels en France.
* Sachez que dans le monde rural de très nombreux petits bourgs ont envie de voir de nouvelles têtes dans leurs grand-rues, des gens qui réveillent le rythme des villages par une présence nouvelle, de nouvelles activités. Ca ne se voit pas seulement à la télé, parce que malgré toute la bonne volonté de gens comme %%Red(Martine Mauléon)%%, tout le monde ne peut pas passer à la télé. Nous avons donc imaginé ces pages d'affichage pour faire se rencontrer les désirs des uns et les besoins des autres.%%%Soyez le sang neuf dans les sillons de nos campagnes, si vous voulez que vos enfants RESTENT A l'ECART DES MAUVAISES FREQUENTATIONS DES BANLIEUES DIFFICILES, A L'ECART DE LA DROGUE OU DE LA PROSTITUTION.%%%A la campagne, ils ne seront plus anonymes, ils n'auront plus besoin de la "bande" pour exister. Ils trouveront toujours quelque chose à faire chez eux, chez vous, qui les valorisera à leur propres yeux.%%%µEt oui, on ne cache rien dans la ListeMartineMauleon, même les choses qui fachent...µ
* Parmi toutes les fables qui ont couru et courent encore sur la bonne politique à mener pour lutter contre le chômage, celle concernant une “préférence française pour le chômage”, dite encore du choix entre emploi et salaires, est l’une des plus connues. Elle a pour fondement l’idée qu’il est impossible de modifier le partage de la valeur ajoutée entre salaires et profits et que la seule répartition modifiable se situe au sein de la masse salariale. Le rapport Pisani-Ferry adopte le même postulat, aussi bien quand il recommande la modération du pouvoir d’achat salarial que lorsqu’il préconise d’ici quelques années d’augmenter de nouveau la durée du travail. Or des marges de manœuvre pour promouvoir l’emploi et restaurer le lien social peuvent et doivent être cherchées dans un partage plus équitable des gains de productivité. Et la réduction du temps de travail constitue une voie privilégiée à condition qu’elle soit considérée comme un processus permanent, parallèle à l’évolution de la productivité du travail. (ATTAC)
ListedArgent
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Il est faux de dire que pour obtenir une femme, il faut soit du temps soit de l’argent. De l’argent il en faudra toujours, par contre vous pouvez gagner du temps ''[Jean Yanne|ListePourJeanYanne]''
*La différence entre l'amour et l'argent, c'est que si on partage son argent, il diminue, tandis que si on partage son amour, il augmente. L'idéal étant d'arriver à partager son amour avec quelqu'un qui a du pognon. ''[Philippe Geluck|ListePourPhilippeGeluck]''
* Le prix de la parole µµEt celui du silence ! -- non justement car "''la parole est d'argent mais le silence est d'or''µµ
* "Je dis, argent, trop cher, trop grand, La vie n'a pas de prix" (''Téléphone - [Argent trop cher|http://www.paroles.net/chansons/10911.htm]'')
* La [plus bath des javas|http://www.frmusique.r&#117;/texts/g/georgius/plusbathdesjavas.htm] par Georgius : (1925) chanson dans laquelle il nous explique que [Nana|ListeDoeuvresSurLaProstitution] gagnait de l'argent à la sueur du nombril...
* Argent [sale|ListeSale] (obtenu par un moyen "méprisable")
* Pour parler franchement, votre argent m'intéresse [http://idata.over-blog.com/1/42/12/52/Photos-Cultes/BNP.jpg]
* Si l'on est attaqué par un [loup-garou|ListeDeLoupsGarous] : essayez de le tuer avec une balle en argent
ListeDeJoueursDeGoDontUnParticulier
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# GASPARI;Peter;3
# PARLOW;Wolfgang;-2
µµtrouvé par hasard sur le site de µµ La Fédération Française de Go
ListeDePoires
/* par PITIE ne mettez pas de liens vers de GROSSES poires. merci
* Quand soudain / semblant crever le ciel / Et venant de nulle part / surgit un kilo de poires... (Barbara)
* Beurre de Paris
* Comtesse de Paris
* Epargne
* Paradis
* Paron Professeur Lagerberg
ListeDePiresVacheriesDeguisees
/* par PITIE ne mettez pas de liens vers de GROSSES vacheries. merci
%%Center(µµpar alpha... soyez pas vache...µµ)%%
* La virginité c'est comme une mouche sur le cul d'une vache, un coup de queue et ça s'en va ! (Proverbe normand repris par Coluche)
* Ma petite vache a mal aux pattes. Tirons là par la queue, elle ira bien mieux, dans un jours ou deux. Kazi-kaza ça ne sera pas toi.
* Pourquoi je prends des bains de lait ? Parce que je n'ai pas trouvé de vache assez haute pour que je prenne des douches. (Cécile Sorel)
* Quand tu commences à voir les vaches comme des vaches, il est temps d'ouvrir ton parachute... ''Général Bigeard''
* Vends onze vaches laitières. Paiements par traites acceptés[http://www.we-make-money-not-art.com/yyy/vache%5B1%5D.jpg]
ListeDeVaEtVient
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeVientEtVa
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListedeMotspourJouerauDictionnaire
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(Ce sont parfois de vrais mots. Dans ce cas, la 'vraie' définition est incluse)%%
** {{n.f.pl} Les paroles que fredonne un marcheur enrhumé (ancien).
** {{n.m} Petit canot utilisé par les navires corsaires pour leur ravitaillement.
** {{n.m.pl} Véhicules de parade, tirés par huit chevaux.
** {{n.m} Mesure de capacité utilisée dans plusieurs parties de l 'Allemagne. 150 litres environ.
** {{n.m} Boulier utilisé par les comptables et marchands grecs.
** {{n.m} Interjection émise par un chanteur français après une donation.
** {{n.f} Pathologie se manifestant par l'utilisation forcenée d'un portable par tous les temps, en tous lieux et à n'importe quelle heure du jour ou de la nuit pour appeler n'importe qui.
** {{n.f} 'Bourrage des urnes' Procédé utilisé par certains partis pour tricher aux élections.
** {{n.f} Prélude aux ébats amoureux chez certains primates consistant à retirer de manière violente les vêtements du partenaire.
** {{n.f} Robe transparente utilisée dans l'administration par les subordonnées pour séduire leurs directeurs.
**{{n.f} Langue parlée par les Awas de Nouvelle-Calédonie
** {{n.m} Oiseau des mers du Nord de l'Europe, apparenté à la mouette
** {{n.m} Particule composée de deux ions positifs
** {{n.m} Petit cylindre de bois employé par les épingliers
** {{n.m} Commentateur sportif dépassé par son sujet
** {{n.m} Terme familier pour désigner le parc des Buttes-Chaumont
**{{n.m} Parasite du lierre
**{{n.m} Fatigue extrême causée par la présence de personnes ennuyeuses
** {{adj} Se dit d'un véhicule tiré par un cheval
** {{n.m} (argot parisien 1900) Synonyme de journaliste
** {{n.m} Arbre renversé par les vents ou le poids de la neige
**{{n.m} Particule sub-élémentaire. Composant du neutrino
**{{n.m} Plante aquatique, apparentée au nénuphar
**{{n.m} Nom donné à la truffe par les auteurs anciens
**{{n.f} Coiffe de parade des evzones
**{{n.m} Genre de poissons acanthoptéres, caractérisés par des rangées de dents en velours
**{{n.m} Candélabre de petite taille, utilisé par les jeunes nonnes
**{{n.f} Désir ardent de la possession, convoitise, particulièrement en parlant des richesses.
**{{n.f} Silicate naturel appartenant au genre grenat
**{{n.m} Jeune animal épargné par les chasseurs
**{{n.m} (Psy) Schizophrène paranoïaque
**{{n.m} Opérateur utilisé pour partager une surface en deux parties égales
**{{n.m} Préfixe, qui placé devant le nom d'un corps, forme le nom d'un composé qui n'est autre que le corps lui-même où deux groupes monoatomiques sont remplacés par deux groupes dipsoïdes. ''dipsecteur-benzène''
**Déesse de la lune, chez les parsis de l'Inde
** Prince osmanli, généralement appelé ''Zisim'' par les occidentaux, fils de Mahomet II et de la sultane Zou-el-Kadr, né en 1459, mort en 1495, frère du sultan Bajazet
** {{n.f} (Hist. ottom) Redevance payée à l'agha des janissaires par les officiers qui entraient en fonction
** {{n.m} Grand manteau de laine porté par les Targuis durant l'hiver
**{{n.f} Vêtement long porté en Italie par les deux sexes au XIVème siècle (robe à large manches retombantes ou fendues)
**(Michel-Auguste) Publiciste français né à Versailles en 1797. Il se signala sous la Restauration par son libéralisme et combattit le gouvernement de Louis-Philippe.
**{{n.f} Grattoir à trois côtés, employé par divers corps de métiers
**{{n.m} Ouvrier chargé d'enlever sous forme d'écailles le sel qui adhère aux parois d'une chaudière
** {{n.m} Planète télescopique, n° 60, découverte en 1860 par Ferguson
**{{n.f.pl} Sandales basques utilisées par les joueurs de jokari
**{{n.f.pl} Parties grossières qui se trouvent au fond d'un vase dans lequel on a fait cuire quelque chose
**{{n.m} Nom donné par Berzélius au carbure d'hydrogène, C££2££H££4££, aujourd'hui appelé ''éthylène''
**{{adj} Se dit d'un animal attiré par la lumière
**{{n.m} Instrument qui fait voir des formes diverses, des changements d'(apparence.
**{{n.f} Appareil qui sert à déterminer l'état de tension des gaz dans une chaudière
** {{n.f} Nom de code utilisé par les dominatrices professionnelles spécialisées dans la clientèle fétichiste.
**{{n.m} Appareil à dents, qui s'adapte à l'avant d'une charrue et sert à enfouir le fumier pendant le labour
**{{n.f} Pièce de bois transversale cylindrique qui fait partie de certains métiers à tisser
**{{n.m} Ancien préposé au mesurage par verge
**{{n.f} Instrument à vent, inventé par Eschenbach vers 1816
**{{n.f} Ouvrage d'art par lequel on déverse à volonté le trop-plein des eaux d'un canal
**{{n.f} Nom donné dans les ministères aux appartements loués gratuitement. Ex: ''Hervé G&#97;ymard a une grosse épanode''
** (Thomas) Mécanicien américain. On lui doit la publication d'ouvrages importants parmi lesquels ''Aperçu descriptif et historique des machines hydrauliques''
**{{n.f} Partie extérieure quelconque d'un navire ou de son gréement.
**{{n.f} Cérémonie religieuse accomplie par les augures et qui avait pour but d'annuler la consécration d'un temple
**{{n.f} Nom qu'on donne, dans les départements du Nord et du Pas-de-Calais, aux ruches
**{{n.m} Facilité à parler, fécondité de paroles
** {{n.m} Ornement d'apparat des druides celtes
**{{n.m} Petit champignon des bois, et par ext., chose sans valeur (voir FIFRELIN)
**{{n.f} Tumeur produite par une inflammation de la peau
**{{n.f} Nom donné par les marins de la Manche aux feux follets
**{{n.m} Lourd javelot des Gaulois des Alpes qui fut adopté par d'autres nations
**{{n.m} Gros vers qui se rencontre parfois dans la peau du cerf, du daim ou du chevreuil
** {{n.f} Allégorie grecque. Porte-parole de la mort aux confluents du Styx.
**{{adj} Qui se détermine, agit, parle spontanément.
**{{n.m} Parachutiste novice.
** {{n.f} Lunette astronomique transformée en périscope d'appartement, utilisée pour espionner le voisinage.
** {{adj.m.} Qui évoque une s&#339;ur par sa douceur affectueuse. ''inceste sororal''
** {{adj.m.} Malédiction prononcée oralement par un être maléfique
** {{n.f.} Se dit de le partie externe de l'appareil génital féminin et du système pileux qui le recouvre
** {{n.m.} Sorte de jeu de criquet pratiqué par les aborigènes australiens
** {{n.m} Psychologie. Prise de contrôle de l'inconscient d'une personne R (récepteur) par une personne E (émetteur). On parle de zythum aggravé si E = R .
** {{n.m} Champignon tropical (parasite des grands arbres).
*C'est curieux comme les mots commençant par les lettres A, B et C sont surreprésentés dans cette liste... par rapport au reste de l'alphabet... Quelqu'un a une explication ?
**Non, dans toute liste composée de mots français, les mots commençant par A, B et C occupent toujours grosso modo le quart de la liste complète.
*La liste n'était plus éditable en raison de l'interdiction des doubles crochets, j'ai donc remplacé les crochets par des accolades, et revu un peu l'orthographe afin de donner une __seconde chance à cette très belle liste.__
ListeDiaboliqueEtCinematographique
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Jean Marais dans Parking, Jacques Demy, 1985 [http://palladio.free.fr/echolalie/DMarais.jpg]
!...où le diable n'est pas incarné par un acteur
ListeSuiteDeListeDeTrainsPourVoyager
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Le Capitole (''µParis - Limoge - Toulouse, 1967-2000µ'')
* L'Orient-Express (''µParis, Strasbourg, Munich, Vienne, Budapest, Bucarest, Constantinopleµ'')
** South America (''µLa Paz - Sajama - Altiplano Bolivia - Surire Salt Flats - San Pedro de Atacama - Atacama Desert - Pan de Azucar National Park - La Serena - Valparaiso - Santiago de Chile - the Lake District (Osorno - Valdivia) - Pucon - Conguillo - the Jesuit trek - Todos los Santos Lake - Puerto Montt - Puerto Natales - Perito Moreno - Ushuaia et Tierra de Fuegoµ'')
* The Bluebell Railway ''(µSheffield Park, Kingscote, Horsted Keynesµ)''
* Le Talgo (''µtrain de nuit Paris-Madridµ'')
* L'Etoile du Nord (''µParis, Bruxelles, Amsterdamµ'')
* La Flèche d'Or (''µLondres-Parisµ'')
* La Malle des Indes (''µLondres, Calais, Paris, Marseille, Brindisi, Le Cap, Calcuttaµ'')
* Le Sud Express (''µParis-Austerlitz, Hendaye, Irun, Madrid, Lisbonneµ'')
* L'Oiseau Bleu (''µParis, Bruxelles, Anvers, Amsterdamµ'')
* Le [Maine-Océan| http://www.editions-verdier.fr/banquet/n43/camera1.htm] (''µParis - Saint-Nazaireµ'')
* Le Transatlantique Express (''µParis-Le Havreµ'')
* Le New York Express (''µParis-Cherbourgµ'')
* Le Train Bleu (''µParis-Vintimilleµ'')
* Le Mistral (''µParis-Marseilleµ'')
* La Palombe bleue (µ''train de nuit Paris-Pau''µ)
* Le Phocéen (''µParis-Marseille by nightµ'' - serait-ce le sleeping du Paris-Méditerranée ?)
* Le TGV Paris-La Rochelle, [bien sûr|http://medias.lemonde.fr/medias/pdf_obj/nouvelle2.pdf]
''µPris en marche par A - Je me souviens du CHAIX.µ'' [http://www.niagara.edu/egr/trainmov.gif]
ListeDeBonnesRaisonsDeNePasBoiredAlcool
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Les ivrognes puent de la gueule et les alcoolos ont une odeur corporelle particulièrement répugnante.
* La plupart des prêtres - hormis ceux de Bacchus - le déconseillent aux autres
* Entre 0,5 et 0,8 gramme par litre de sang en voiture : 135 &#8364;, 6 points au permis
* Parce que c'est vilain
* Un verre de vinasse (ou mieux, plusieurs) permet d'occulter au moins partiellement les redoutables fragrances dues à un bout de maroilles resté coincé entre deux chicots
* L'éthanol permet de prendre, momentanément, quelque recul par rapport à ce monde de merde
* La plupart des plus grands génies se torchaient sérieusement la gueule (Modigliani, Beethoven, Staline, Jésus-Christ, Fernand Raynaud, Sofronitski, Winston Churchill, Francis Blanche, Montand-Signoret, Rouault, Jim Morrison, Noé, Nixon, le chanoine Kir, Kessel, Roger Nicolas, Mustapha Kémal, Alphonse Allais, Samson François, Henri Krasuki, Maupassant, etc.)
* ''Au paradis d'Allah, il y aura du vin de Moselle et des houris en minijupe'' (sourate #421-666 bis)
ListeDeBonnesResolutionsPourDeuxMilleQuatre
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* une assemblée générale par trimestre
* des beeeeelles images [comme là|http://mapage.noos.fr/echolalie/2004.htm] par ailleurs
ListeDeSaucisses
/* par PITIE ne mettez pas de liens vers de GROSSES saucisses. merci
* Hot-Dog : Bout de Pain tranché dans lequel on a fait cuire une saucisse de Strasbourg ou une saucisse de Frankfort (laquelle est rouge, laquelle est orange ?) avec un peu de gruyère. On rajoute à la fin de la moutarde ou d'autres bêtises. Est parfois d'une consommation agréable quand le pain n'a pas été trop cuit, sinon c'est dégueu...
* [Jésus|ListeDeJesus] ([variante|http://www.routard.com/partir_destination.asp?id_destination=86&id_generalite=866] de la saucisse de Morteau)
** On appelait parfois saucisses certains dirigeables (mais c'était au temps des dirigeables)[http://www.aerostories.org/~aerobiblio/IMG/arton303.jpg]
*Liste sponsorisée par :
*et testée par le secrétariat
µµCompilée par MGµµ
ListeDeContrairementaToutLeMonde
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* je ne parle pas [mode|ListeDesExpressionsaLaMode]
* parler du temps qu'il fait
ListeDeLarmes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(''Goutte de l'humeur liquide, transparente et salée qui s'écoule des yeux sous l'effet d'une atteinte physique douloureuse ou d'une émotion'')%%
* Si vous voulez pleurer, c'est par ici : ListeDeVideosQuiVontVousFairePleurerEnMoinsDeDeuxMinutes
* Les Larmes du Soleil (Tears of the Sun), film réalisé par Antoine Fuqua (2003)
''µµPleurée par A.sur l'air de [Cry me a river|http://www.geocities.com/missdaphneq/crymeari.html]µµ''
ListeDePinces
/* par PITIE ne mettez pas de liens vers de GROSSES pinces. merci
ListeDeFeux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Pare-feu
* Liste incrémentée dans ce wiki par El Jj - µLe processus est-il récurrent ?µ
ListeDeTimbresNombreux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeLions
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Sa reproduction place Denfert Rochereau, Paris
[http://www.parisbalades.com/Photo1/photo15/Place_Denfert-Rochereau.jpg]
/*[http://apartes.free.fr/photos/photospetites/lionlemotp.jpg]
/**µµpompé sur ce joli site, [où|http://apartes.free.fr/], en cherchant bien on trouvera d'autres lionsµµ
* Le lion du Crédit lyonnais µ(il coûte combien d'&#8364;uro par français déjà ?)- pardon ?µ
* Les huits lions de la place Felix Eboué, Paris (Métro Daumesnil)
[http://www.pariswater.com/fontaines/eboue2.jpg]
[http://www.monnaiedeparis.fr/images/euro/Fi5c.jpg]
* Les lions de la place de la Fontaines aux lions, Paris (Métro Porte de Pantin, Porte de La Villette)
[http://www.pariswater.com/fontaines/vilette4.jpg]
* Léonidas, le lion martyrisé par l'insupportable Grabote
** Et par extension le(s) lion(s) d'or de la Mostra de Venise
* Fontaine aux lions de l'Alhambra (copie à Morlanwelz, parc de Mariemont) [http://www.sculpturepublique.be/7140/Anonyme-FontaineAuxLions.jpg]
* Alain Delon (µµexplication ?)µµ -- µµJe suppose que l'humoriste voulait marquer Alain Delion - et aussi parcequ'il a joué dans l'adaptation médiocre du Lion de Kessel...µµ (ou alors c'est un allusion au [Guépard|ListeDeGuepards])
ListeDeSerpents
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
** Mais pourquoi parles-tu toujours par énigmes ? - Je les résous toutes.
** Paroles: Rodor. Musique: Vincent Scotto   1922
Et mordu par le venin du mal
Tu sais que mon cœur t'appartient tout
Pour la revoir il la cherche partout
Pour toi il a quitté le travail, les parents
Alors sans pitié froidement il étrangla
[Texte|http://www.paroles.net] soumis aux Droits d'Auteur - Réservé à un usage privé ou éducatif.     
* hypnotiseur [http://www.disneyparoles.com/personnages/images/lelivredelajungle_kaa.gif]
ListeDeMoutons
/* par PITIE ne mettez pas de liens vers de GROS gigots. merci
* Compter les moutons (on vous ne remet une autre parce que ça ne marche pas toujours du premier coup) [http://idata.over-blog.com/2/32/49/05/gif4/bourse-mouton.gif]
ListeRoyale
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Le roi Kurt souverain de la [Kurtlandie|ListeDePaysImaginairesDansLesLivresEtAuCinema] dont le souverain est le roi Kurt (père de Blanche-Neige) dans les "Contes Malicieux" adaptation érotique des aventures de Blanche Neige (Biancaneve en Italien) parue en France chez [Elvifrance|ListeDesHeroinesElvifrance] entre 1974 et 1980.
* Rue Royale [http://www.traction.ch/postcards/pics/Paris1.jpg]
ListeDeSurnomsAffectifs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci__)%% !!
* Chichourlet : Sobriquet affectueux. Féminin = chichourlette. ''Viens par ici, ma chichourlette !'' (parler marseillais)
* Chochotte µ''(par ailleurs nom d'un très sympathique club de strip-tease, près de la place St Michel à Paris)''µ[http://perso.wanadoo.fr/camalot/IMAGES/ChochotG.jpg]
* Cocotte (ou ma cocotte) [http://www.parigramme.com/datas/Couverture/l/e/les-cocottes-reines-du-paris-1900/l/les-cocottes-reines-50732c229e003.jpg]
%%Image(http://lassilia.voila.net/Image_dico/Kiki_Montparnasse_1922.jpg,200,300)%%
* Reclassée, dépolluée et ordralaphabétisée par les service des O.
µµListe confectionnée par ?µµ
ListeDeCeQuiMeFaitJouir
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(µµGabrielle d'Estrées et sa sœur la duchesse de Villards (école de Fontainebleau, anonyme 1594 - paris musée du Louvre)µµ)%%
* Les [escorts girls|ListeDeParolesdEscorts]
* Sentir un parfum de femme [http://sachatchenko.voila.net/fleurdescort.jpg]
** Un para-graf
* Un joli pied habillé de vernis rouge µµPourquoi toujours du vernis rouge? -- parce que j'aime bien !µµ
* Une épaule dénudée et bronzée dans le métro parisien [http://sachatchenko.voila.net/2blondes.jpg]
Liste de Voeux de jouissance exaucé par la bonté divine
* Moi, ce qui me ferait bien jouir, c'est que Paris ne soit pas retenu pour organiser le cirque olympique en 2012.
ListeDesDixFilmsPreferesDeLanDernier
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Chronique d’une disparition
* Terminus Paradis
* ''Ken Park''
* ''Paradise Now''
ListeDeDahus
/* par PITIE ne mettez pas de liens vers de GROS dahus. merci
[http://perso.orange.fr/locations.vallerian/images/cliparts/dahu-plan2.jpg]
*ListeDeListesAnimalieres/*pourquoi ce lien ?-- sans doute parce qu'il est d'usage, lorsqu'une liste est listée par une métaliste, d'établir un lien, depuis la liste listée, vers cette métaliste qui la liste.
*Dahu (chanson magnifique du Club des chats, Paris)
µµcréée par P.init 07 01 04 et rénovée par l'association internationale pour la réhabilitation du dahu - AIRDµµ
ListeDeChiens
/*Par pitié des chiens assez légers... sinon ça mord
!Toutounymes particuliers
* Argos (le chien d'Ulysse.µ avant le passage de l'être intelligent et sensible qui par étourderie, sans doute, a confondu Echolaliste avec Coprolaliste (ça semble fréquent ces temps) quelqu'un demandait ici ''"ce n'est pas plutôt le nom d'un bateau ?"'', et il lui était répondu que le bateau de Jason s'appelait Argoµ -- µµintelligence et sensibilité ne sont en rien de fait contradictoire avec la coprolalie, mais sans doute me mêle-je de choses qui ne me regarde pointµµ
* Maurice (en compagnie de Patatapon, le chat) par Charb[http://www.poptronics.fr/local/cache-vignettes/L425xH315_jpg_Sans_titre_-_14-a1a17.jpg]
* Patau (ou Pato, ou Pateau, ou Pataud ?) "Toi mon vieux Pato, t'es pourtant qu'une pauv'bête, mais t'as bien plu'd'c&#339;ur qu'la plupart des zumains..." Chanson démago "interprétée" par Berthe Sylva dans les années 1930
** Et donc une partie des dalmatiens : Pongo, Perdi, Rolly, Patch, Penny, Lucky, Biscotte, Pepper. Le Colonel, Prissy, Coco, Grognard, Lucie, Collie, Ouragan.
* Sparky
*Un français a été retrouvé mort ligoté à un arbre, son chien était parti en vacances...
* Placid ( à moins que ce soit Muzo - l'autre est un chat - Placid et Muzo par Arnal dans Pif...)
ListedErreur
/* par PITIÉ ne mettez pas de liens vers de GROSSES images. merci
* L'avion, c'est pareil que le cinéma, il n'y a que des erreurs humaines. Un mauvais film, c'est une erreur humaine. ''Gérard Depardieu µµ(en pleine forme)µµ''
* N'interrompez jamais un ennemi qui est en train de faire une erreur. ''Napoléon Bonaparte''
* Erreur de contrôle parental [http://nikosolo.voila.net/parental.jpg]
** µPar chance, la cour d'appel, dûment conseillée, ne va pas reproduire la même erreur, qui aurait risqué de priver la France d'un homme d'une telle valeurµ
ListeDesObjetsPouvantServirCommeObjetsSexuels
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
*** ... mais ne pas d'emblée commencer par ce dernier flacon !...µµ
* Statuette de la Vierge™ en plastique phosphorescente achetée à Lourdes et à des simoniaques, et bénie par le Pape (20 cm sur socle) "une belle présence pour la chambre des petits !"%%%
* Télécommande : comme elle traîne toujours au creux du fauteuil ou du canapé, forcement Raymonde (ou Raymond) fini par s'assoir dessus, et alors...
* XFLR-6, la fusée des aventures de Tintin (Son utilisation sexuelle est précisée par Hergé dans le titre même d'un des albums... Objectif : lune !...)
* Deux doigts (Trois ça rentre pas, dixit Frigide Barjot) --- pas un objet et par ailleurs trois doigts ça rentre ! µµJe confirme !µµ
Liste participante à la ListeDesListesCoquines
ListeXx
/* par PITIE ne mettez pas de liens vers de GROSSES images X. merci
* La __génération X__ serait "la jeunesse sans identité, jeunesse issue de la Révolution tranquille qui a grandi dans la promesse d’un avenir meilleur. Cependant, arrivée à l’âge de travailler, cette génération a été confrontée à la crise de l’emploi des années 1980. Décrite par les médias comme une génération sacrifiée, largement apolitique, égocentrique."
** Objection Votre Honneur. L'inéffable Gaston n'a finalement pas été candidat à l'érection pestilentielle de 1965 (c'est F.M. qui a mis le Vieux en ballotage, ce qui était alors un exploit), mais seulement le candidat présumé et potentiel d'une partie de ce qui était alors la SFIO pour éviter que ce crâne d'oeuf de Guy Mollet le fut. L'opération, montée par L'Express foira et Gaston ne fut pas candidat. On ne joue pas avec l'Histoire.
* "XXL" Film avec Depardieu père
* Comparons à la lessive X... (''vieille pub...'')
* ''Classée X, excès de sexe, Classée X, à l'index, classée X, parce qu'ex-''(Jane Birkin) µPas plutôt chanson de Serge Gainsbourg chantée par J.Birkin ?µ
* AXA, nom choisi par Claude Bébéar pour ses diverses connotations dans plusieurs langues dont il visait les marchés nationaux. --si on met tous les mots avec un x dedans on a pas fini... bijoux, cailloux, hiboux, joujoux, choux, genoux...
ListeDeFous
/*Par pitié ne mettez pas d'images de gros fous. merci
* J'aime l'idée du mariage parce que c'est un acte d'héroïsme. Un type qui accepte de dire "pour la vie" à une femme, c'est aussi fou que Rambo ! (Claude Lelouch)
* Le fou n'aime pas la marche... Pourquoi ? Parce qu'il la rate ! (Raymond Devos)
** ils ont tout fait, connaissent tout, ont toujours raison, tiennent à le faire savoir et considèrent tout les autres comme de parfaits imbéciles
**''Sur le forum de Cerclo aujourd’hui disparu, un mec est allé jusqu’à mettre en scène sa propre mort, il est réapparu ensuite sous un autre pseudo, prétendant être le frère du défunt, et accusant les autres participants d’avoir contribué au décès de celui-ci (archives sur demande)'' µµon les demande à qui ?µµ
** souvent déconnectés de la réalité, ils en arrivent à participer à des créations collectives, à se noter eux-même, et à se satisfaire du résultat.
** Se pointent sur un forum ou sur un wiki et commencent par en contester les règles. Finissant par se faire rejeter par les administrateurs voire par les autres participants, ils braillent ensuite à la censure.
* [Cléomène II|http://boutique.info-grece.com/product_info.php/cPath/21_24_137/products_id/4284], roi de Sparte (à la fin)
* Georges III (à la fin) --dit fou par son entourage mais aurait plutot été atteint d'une maladie génétique
* Foutriquet µ(cf ''Précis de foutriquet'', consacré à Giscard par le regretté PA.Boutang)µ
* "J'ai un projet: devenir fou!" (''Fiodor Dostoïevski'') µ(repris comme titre d'un de ses livres par ''Charles Bukowski'')µ
ListeDePingouins
/* par PITIE ne mettez pas de liens vers de GROS pingouins. merci
* Alfred, avec Zig & Puce créés par Alain Saint-Ogan (qu'Hergé lui-même considérait comme son maître)
** Les mêmes par Greg (avec qui Hergé fut moins fair-play, mais c'est une autre histoire)
[http://takalir.org/lks/fichiers/1/img/para/11-2-15/pingu.gif]
* Les pingouins martyrisés par un yéti (lien mort)
ListeDeNomsCommunsFemininsQuiSeMasculinisentEnLeurAjoutantUneLettreAlaFin
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
**part
**partie
JoeY (ListeDesListesInitialiseesParJoey)
ListeDeChosesEnervantesaLaTele
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Patrick Lelay (PDG de TF1) : "Il y a beaucoup de façons de parler de la télévision. Mais dans une perspective ”business”, soyons réaliste : à la base, le métier de TF1, c’est d’aider Coca-Cola, par exemple, à vendre son produit (...). Or pour qu’un message publicitaire soit perçu, il faut que le cerveau du téléspectateur soit disponible. Nos émissions ont pour vocation de le rendre disponible : c’est-à-dire de le divertir, de le détendre pour le préparer entre deux messages. Ce que nous vendons à Coca-Cola, c’est du temps de cerveau humain disponible (...). Rien n’est plus difficile que d’obtenir cette disponibilité. C’est là que se trouve le changement permanent. Il faut chercher en permanence les programmes qui marchent, suivre les modes, surfer sur les tendances, dans un contexte où l’information s’accélère, se multiplie et se banalise. " AFP 9 juillet 2004 - cité par www.acrimed.org
* L'invraisemblable matraquage de la participation de nos élus et dirigeants au fameux ''travail du deuil'' pour les pauvres bougres qu'un charter pourri a envoyé en pature aux requins de la Mer Rouge
** µOui, Einstein disait la même chose de sa formule E=mc2. Et je m'interroge parfois sur le bien-fondé de l'invention de l'écriture.µ
* La grande tribu des ''animateurs-présentateurs-frimeurs-etc.'', qui feraient passer les peu regrettés Lux, Marcillac ou Zitrone pour des parangons de culture, de sobriété et de courtoisie
* La stupéfiante sottise des commentateurs sportifs (Nelson Montfort, le nouveau Dumézil du PAF, Gérard Holtz, que ses collègues qualifient aimablement de "Petit trou du cul", Thierry Roland, qui préfère voir les Arabes rester à leur place, les ânes qui s'occupent du cyclisme, qui n'ont jamais entendu parler du dopage mais ne nous épargnent, ''ad nauseam'', aucunes des expressions du milieu qu'ils ont appris la veille, etc.)
* Les mines adoptées par les journalistes-sic lorsqu'ils nous infligent leurs conneries : un avion occidental qui tombe ou un chien blessé à Montauban, mine affligée, une inondation au Bengale ou un massacre à Madagascar, attitude neutre et informative, trois bagnoles qui crament au Val-Fourré, un air angoissé et réprobateur, un solipède qui gagne au Loto, une mine extasiée, etc.
* Le halo bleuté qui entoure chaque maison, appartement et mobile home de France tous les soirs à 20 heures, car Patrick Poivre d'Arvor est en train d'informer nos concitoyens sur l'état de l'univers.
* Ces journalistes-sic qui ne sont que des mondains paresseux et ignorants tout des dossiers, et qui recevant complaisamment ceux avec qui ils se gobergent tout au long de l'année sont parfaitement incapables de les contredire ou de les arrêter lorsqu'ils servent leur infâme propagande sur leurs chaînes de merde.
**Restez correct voulez-vous, je regarde la télé quotidiennement et ne pense pas faire partie de la lie intellectuelle de ce pays....
Liste créée par El Jj
ListeDeSousVetements
! /* par PITIE ne mettez pas de liens vers de GROS sous-vêtements. merci et quand on dit grosses images il s'agit de la taille en octet, pas de la taille en centimètres, il ne sert donc à rien de les réduire à l'état de timbres postes ! Grrrr.....
* Entre le soutien-gorge et la culotte, s'étend cette brève zone de chair nue, boursouflée par les élastiques : étonnante erreur de la mode qui scie en deux le tronc féminin ! ''Hervé Bazin''
* Je sors sans sous-vêtements, je déteste quand on les distingue sous une robe, je trouve ça tellement vulgaire. ''Paris Hilton''
* Le String éclipse partiellement la lune. ''Paulo Vincente''
* Si Superman est tellement malin, pourquoi est-ce qu'il met son slip par dessus son pantalon ? ''Pierre Legaré''
** Se nomme Brassière au Québec ! Mais à l'origine il était un peu différent (c'était un type de soutien-gorge à larges bords ou de haut moulant qui s’enfilait) par la tête.
***µLe soutien-gorge est le plus petit paradis au monde, il n'abrite que deux saints.µ
* bonnets : chacune des poches d’un soutien-gorge : Dans les années 50, la marque Empreinte invente en France 3 profondeurs de bonnets A, B et C. Le D naîtra en 1960 et le E en 1962. Les autres marques adopteront ce système progressivement... Auparavant la profondeur du bonnet était simplement proportionnelle à la mensuration.
***µµben oui pareil que wassingue ! (c'est fait de la même étoffe)µµ
* Culotte (petite) : inventé en janvier 1918 par Pierre Valton
** le string est le VRAI symbole de la Démocratie. Il sépare la droite de la gauche, il soutient la masse, arrondit les bords et attire le peuple.
*** µ''sous la culotte, parce que c'est plus pratique pour faire pipi !''µ
* dossière (culotte fendue par-derrière)
%%Image(http://colombine65.free.fr/dany/paraBD/divers/dany.jpg,385,275)%%
**Moule-Bite µ(encore dit ''poutre apparente'')µ
* Bonnichon : Parce que un bonnichon c'est un petit bonnet... mais pas un petit bonnet de soutien gorge, non un petit bonnet qu'on met sur sa petite tête...
**quoique parfois µ(souvenez-vous de Salomé)µ
*Il existait un site intitulé UPLM - Union Pour La Monarchie - Parti Politique Royaliste - ce qui déjà en soi un sujet de franche rigolade... Mais ces gens là se mêlaient aussi de santé et au milieu de considérations diverses qui serait hors sujet sur cette liste, ils nous avisaient que :
**"Changer de sous-vêtements du bas Trois fois par Jour Contribue au Bien-être." µµMajuscules garanties d'origine.µµ
*Je ne regarde plus les publicités montrant des modèles féminins plus ou moins déshabillés, j'ai appris que les publicités pour les soutien-gorge et les petites culottes pouvaient me transformer en violeur potentiel, j'ai rayé tous les noms appartenant à la lingerie féminine de mon vocabulaire. Et quand je suis en érection, pour me calmer je pense à Casimir.[http://nikosolo.voila.net/Pastiches_tab/casimir_venus.jpg]
µµen hommage à Nathalie qui aime tant les "bouts de chiffons" par Eddyµµ
ListeCeQueJePossede
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Des parents
* Des grands-parents
* Un appareil photo
ListedOulipo
/* par PITIE ne mettez pas de liens vers de GROS oulipos. merci
**Que Simplon soit Parmentier
* Oulipo-des [fesses|ListeDeMotsRelatifsAlaPartiePosterieuredesHumains]
* µµIl y en a 2 ou 3 qui n'ont rien compris à l'esprit de la liste, mais comme dirait notre vénéré Ouaibmestre, "c'est normal, c'est un wiki !" - Il ne tient qu'à vous, qui paraissez affranchi, de préciser sur ce wiki quel est ''l'esprit de cette liste''. - J'ignore pour ma part si cette liste a un esprit, mais il n'est pas difficile de faire la différence entre (par exemple) Oulipo-de chagrin et Oulopo-rtugais, si vous ne la faites pas, je ne peux hélas rien pour vous...µµ
ListeDeCommentCaVa
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Beethoven : ''Pardon ?''
*Blaise Pascal : ''Je parie que ça va aller mieux !''
*Dr Jekyll : ''Je suis assez partagé...''
*Heidegger : ''Comment, je ne sais pas, mais ça ne va nulle part.''
*Maurice Blanchot : ''Dire que j'entends ces paroles, ce ne serait pas m'expliquer l'étrangeté dangereuse de mes relations avec elles. Est-ce que je les entends? Je ne les entends pas à proprement parler, elles aussi qui participent à la profondeur de la dissimulation demeurent sans entente.''
*Vincent Van Gogh : ''Parlez plus fort, j'entends mal de cette oreille...''
ListedAnges
/* par PITIE ne mettez pas de liens vers de GROSSES mésanges. merci
* Michel (L'archange) : Quand Lucifer prit la tête de la rébellion des anges fêlons, c'est l'archange St Michel qui prit le commandement des anges restés fidèles à Dieu, il vainquit Lucifer et le précipita en enfer où il devint [Satan|ListeDeDemons], prince des ténèbres µ(saint patron des parachutistes et des aviateurs - mais non des voleurs; là, c'est Mercure, ou Hermès)µ[http://mysticplanet.com/MICHAEL.JPG]
* Marie-Ange µ(par exemple Marie-Ange Nardi, celle qui animait "Qui est qui ?")µ
* Angela µ(par exemple A.Davis)µ
* ''Le Combat de Jacob et de l'ange'' µ(par d'Eugène Delacroix)µ
* Adolphe-William BOUGUEREAU (1825-1905)[http://lecoeurevanaissant.free.fr/pages/Artistes/Bouguereau/Ame%20conduite%20au%20paradis,%20Bougereau.jpg]
* "''La vallée de l'Ange...''" (µµdit par Ingrid Bergman dans ''La Maison du Docteur Edwards'' d'Alfred Hitchcockµµ)
* ''Farewell Angelina'' µ(de et par Bob, dit l'Ane)µ
* ''Les [anges|http://www.themegawave.com/paroles/voir.php?idtitre=5113&idinterprete=108] noirs''
* Angel tranny : Désigne une transsexuelle n'ayant pas subi de transformation (ou très peu) au niveau de la poitrine. Par contre le corps est épilé, et le visage féminisé ! Très troublant !
* L'angélique µ(qui souvent en Provence décore, et parfume, la ''pogne'')µ
* La part des anges µ(la partie du cognac qui s'évapore dans les fûts - entre les caisses)µ
* Un ange passe µµLors d’un dîner, un convive s’étonnait du silence soudain qui régnait autour de la table. Sans doute impressionné par la proximité du poète, le malheureux hasarda un "Un ange passe" un peu court auquel Cocteau répliqua sans sourciller "Qu’on l’encule" –-- µµj’aimerais bien la source.µµ
**µ'' 1941 : Les personnes suspectées d'avoir participé à un avortement peuvent être déférées devant le tribunal d'État.''µ
* Le col de l'Ange µ(vers Aix-en-Provence et Cuges-les-Pins, le Tour y passe parfois)µ
ListeVeronica
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* __Double Vie de Véronique, La__ par Krhjystowphf Khyjilsofwskhyi
* __Veronica serpyllifolia__ : Véronique à feuilles de serpolet, thym et farigoule, parfums d&#8217;escapade et de vacance
** Veronika, der Lenz ist da, die Mädchen singen tralala. Die ganze Welt ist wie verhext. Veronika, der Spargel wächst. Veronika, die Welt ist grün - drum laß uns in die Wälder ziehn. Sogar der Großpapa sagt zu der Großmama : Veronika, der Lenz ist da !
** Veronika, der Lenz ist da, die Mädchen singen tralala. Die ganze Welt ist wie verhext. Veronika, der Spargel wächst. Veronika, die Welt ist grün - drum laß uns in die Wälder ziehn. Sogar der Großpapa sagt zu der Großmama : Veronika, der Lenz ist da !
** Veronika, der Lenz ist da, die Mädchen singen tralala. Die ganze Welt ist wie verhext. Veronika, der Spargel wächst. Veronika, die Welt ist grün - drum laß uns in die Wälder ziehn. Sogar der Großpapa sagt zu der Großmama: Veronika, der Lenz ist da !
** La demoiselle rit, l'adolescent parle : Mademoiselle, voulez-vous ou non ? Le printemps est dehors. Le Poète d'essence lumineuse considère comme son devoir de lui écrire ce poème :
** Veronika, le printemps est là, les jeunes filles chantent "tralala", le monde entier est comme métamorphosé, l'asperge se dresse. Veronika, le monde est vert, laissons-nous attirer par les forêts. Même le grand-père dit à la grand-mère : Veronika, c'est le printemps ! Allez Véro, quoi, on baise !?
µµliste créée par [LP|ListeDeLp]µµ
ListeDeDemons
/* par PITIE ne mettez pas de liens vers de GROS démons. merci
* Aghation : Démon facétieux. Il n'apparaît qu'à l'heure de midi soit sous forme humaine bestiale ou composite. Se laisse enfermer volontairement dans une boite, une bouteille, un récipient, un livre ou une bague.
** Mais peut-être bien surtout Belzebûl, "seigneur des princes", déformé par les Hébreux en Belzebuth "seigneur des mouches"
* Celui qu'on tire par la queue [http://marjorie-art.voila.net/tirez_diable.jpg]
* Diablesse par Berthet [http://www.objectible.net/objectible/Interviews/InterviewBerthet/images/CapryssProto.jpg]
* Focalor : Général aux enfers. Apparaît sous les traits d'un homme avec des ailes de griffon. Commande à la mer et aux vents
* Léonardo : Quand un sabbat est organisé par des sorcières, c'est généralement ce démon qui apparaît. C'est lui qui supervise tout ce qui ressemble à de la magie noire, de la sorcellerie ou de l'invocation satanique ! Il a souvent la forme d'un bouc (en rut, cela va de soi) avec 3 cornes et des oreilles de renards, et possède un visage au dessus du cul. C'est ce visage que les sorciers embrassent.
µµ%%Center(Lilith par Nicolas Solovionni - 2006)%%µµ
* ListeDesIconesDEMONBureau (le démon de la paresse)
**première opinion : Lucifer serait un démon supérieur, mais loin derrière Satan et la lumière astrale ! Apparaît souvent sous le masque d'un bel enfant ! Très joueur... planque les balais des sorcières...
**Nom du Christ de sectes gnostique ("qui apporte la lumière"), puis satanisé par les actionnaires majoritaires. Il existe encore des sectes lucifériennes qui n'ont rien de sataniques (sauf ceux qui se réclament de l'orthodoxie).
* Remmon : Toubib personnel de Belzebuth (où on apprend que les démons sont parfois malades)
* Satan : Alors au commencement, Satan était un Ange et gouvernait une partie septentrionale du ciel (on ne rigole pas) Il mena la révolte contre Dieu mais fut vaincu (cette bonne blague) déchu et précipité dans l'abîme de l'enfer, où il bâtit son nouvel empire.
* Vapula : rend l’homme très adroit en mécanique et en philosophie ''(ah les mécaniciens philosophes !)'' et donne l’intelligence aux savants ''(parce que des savant pas intelligents ça existe ?)'' ''Donc si votre 4 x 4 est en panne, pas la peine de la porter au garagiste, il suffit d'évoquer Vapula !''
ListeTropLongueaCharger
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDePouquoiCertainesListesMarchentEtDautresPas
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Pour leur incomparable sagesse
* Pour @@paraître@@ devenir intelligent
* Par verve littéraire
* Pour faire partager
* Par nostalgie
* Par hasard
* Parce qu'elles font appel à nos plus bas instincts
* Parce qu'elles parlent de bonnes choses
* Parce qu'elles attirent les bavards
* Par leur mécanisme répétitif
* Par esprit de compétition
* Par amour
* Par bravade
* Par déformation professionnelle
* Par manque d'illustration (eh ! eh !)
ListeLePrintempsEstArrivePar
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# par abnégation
# par accident
# par acquis de conscience
# par ailleurs
# par amour
# par amour (ou par pitié)
# par analogie
# par avion
# par carte bleue
# par charité
# par ci, par
# par cimonieusement
# par contamination
# par déduction
# par derrière (a tergo)
# par désoeuvrement
# par dessus bord
# par devant, par derrière (comme de bien entendu)
# par DHL
# par effraction
# par enchantement
# par ennui
# par erreur
# par étourderie
# par exemple
# par grandeur d'âme
# par hasard
# par ici (il repassera par là)
# par inadvertance
# par induction
# par inhalation
# par (in)juste retour des choses
# par intérêt
# par intermittences
# par internet
# par la bande
# par l'anus
# par l'arrière
# par l'autoroute
# par l'entrée des artistes
# par l'opération du Saint-Esprit
# par la Chine (à pinces)
# par la face nord
# par la femme de chambre [http://www.optimistique.com/pierre.et.gilles/images/lio/lio11.jpg]
# par la fenêtre
# par la fin
# par la force de l'habitude
# par la force des choses
# par la grace de Dieu
# par la grande porte
# par la Lorraine (avec ses sabots)
# par la méthode des moindres carrés
# par la porte de derrière (Referme pas, j'arrive !)
# par la poste
# par la voie des airs
# par la volonté du Grand Albert
# par la volonté du peuple
# par la force des baïonnettes
# par le cap de Bonne Espérance
# par le début
# par le petit bout de la lorgnette
# par le plus grand des hasards
# par le pont des Arts
# par le siège
# par le train !
# par le trou de la serrure
# par les Galeries Lafayette
# par les liens sacrés du mariage
# par les trous de nez
# par mail
# par mer calme
# par mimétisme
# par minou
# par miracle
# par mois
# par monts et par vaux
# par 1000 mètres de profondeur
# par notre bon plaisir
# par obligation
# par ouï-dire
# par pensée, par parole et par action
** et par omission
# par petites secousses
# par pitié
# par plaisir
# par porteur spécial
# par principe
# par procuration
# par pure bonté
# par pure provocation
# par quatre chemins
# par raccroc
# par Ravaillac
# par recommandé
# par retour du courrier
# par sa seule volonté
# par satellite à haut débit bidirectionnel
# par substitution
# par surprise
# par symétrie
# par thénogenèse
# par Thor
# par Toutatis
# par un bel après midi
# par un chemin détourné
# par un fait exprès
# par un trou de souris
# par une enveloppe mauve parfumée
# par une nuit sans lune
# par une ou plusieurs personnes inconnues
# par vent arrière
# par véloprocesseur
# par voie intramusculaire
# partibvs
''µµpar Choriµµ''
ListeDeLieuxDontJeMeSouviensEtDeChosesSyRapportant
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Je me souviens de l'appartement de la __rue Claude Pouillet__, et du lit derrière l'armoire de la cuisine...
* Je me souviens de la maison glaciale et humide de __San Momme__, où "on" avait fini par nous prêter un radiateur!
* Je me souviens d'un trajet de nuit par l'autoroute entre Vesoul et __La Bouverie__. C'était la première fois qu'"on" m'invitait en vacances...
* Je me souviens du parking de __Devecey__ et d'un gros camion de déménagement...
* Je me souviens des deux appartements successifs de M., __rue de Franche-Comté__, à Planoise...
* Je me souviens d'une traversée en bateau vers __l'Irlande__ où beaucoup de gens vomissaient parce que "le bateau avait coupé les moteurs pour récupérer un cadavre", et ça secouait vraiment beaucoup
* Je me souviens d'être parti en stop pour __Stonehenge__ (et d'y être arrivé!)
* Je me souviens des ''petits jets'' rafraîchissants sur la -par ailleurs- épouvantable aire de __Montélimar__*
* Je me souviens de C.,qui, faisant du stop à la sortie de Dijon, avec un panneau "''Joyeuse''", avait été pris par un mec qui allait... à __Joyeuse__!
* Je me rappelle d'un coup de frein de D., dans __La Ferté__ quelque chose, pour me réveiller parce qu'elle ne trouvait pas la route...
* Je me souviens d'avoir été émerveillé par une arrivée nocturne à __Montluçon__, et de l'avoir associé à la phrase de Bohringer ''C'est beau une ville la nuit''
* Je me souviens que , la première fois je suis passé à __Ellis Island__ , ça ne m'a fait ni chaud ni froid parce que j'ignorais ce qui s'y rapportait
ListeMadagascar
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*µ"C'est Madagascar qui affleure le plus souvent au souvenir de Valentin Brû, tout au long du ''Dimanche de la vie'', de façon curieusement imprécise, sous formes de questions parfois laissées sans réponses. C'est ainsi que Brû se dérobe régulièrement lorsque son beau-frère le questionne sur la flore malgache" (...) Lorsque Paul lui demande ce qu'il a vu comme plantes à Madagascar, Brû se contente de répondre : "Beaucoup sont exotiques" .µ
* Vanille de Madagascar - la meilleure parait-il.
* Veloma, mystère en terre malgache (avec Julie Depardieu)
* Madame Gaspard
* Il me semble qu'elle manquait sur ce Wiki (mais pourquoi ne pas l'appeler "Liste malgache" ?) - Parce que !
ListeDesDeuxVachesEtLaPolitique
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**Vous avez 2 vaches. Vos voisins vous aident à vous en occuper et vous partagez le lait.
**Vous avez 2 vaches. Un vote décide à qui appartient le lait.
**Vous avez 2 vaches. Une élection désigne celui qui décidera à qui appartient le lait.
**Vous avez 2 vaches. Vous écopez d'une amende pour détention de bétail en appartement.
**Vous avez 2 vaches. Vous en vendez 3 à votre société cotée en bourse en utilisant des lettres de créance ouvertes par votre beau-frère auprès de votre banque. Puis vous faites un " échange de lettres contre participation ", assorti d'une offre publique, et vous récupérez 4 vaches dans l'opération tout en bénéficiant d'un abattement fiscal pour l'entretien de 5 vaches.
**Les droits sur le lait de 6 vaches sont alors transférés par un intermédiaire panaméen sur le compte d'une société des îles Caïman, détenues clandestinement par un actionnaire qui revend à votre société cotée les droits sur le lait de 7 vaches. Au rapport de ladite société figurent 8 ruminants, avec option d'achat sur une bête supplémentaire. Entre temps vous abattez les 2 vaches parce que leur horoscope est défavorable
**Vous avez 2 vaches. Pour financer la retraite de vos vaches, le gouvernement décide de lever un nouvel impôt : la CSSANAB (cotisation sociale de solidarité avec nos amies les bêtes). Deux ans après, comme la France a récupéré une partie du cheptel britannique, le système est déficitaire. Pour financer le déficit on lève un nouvel impôt sur la production de lait : le RAB (remboursement de l'ardoise bovine). Les vaches se mettent en grève. Il n'y a plus de lait. Les Français sont dans la rue : " DU LAIT ON VEUT DU LAIT". La France construit un lactoduc sous la manche pour s'approvisionner auprès des Anglais. L'Europe déclare le lait anglais impropre à la consommation. On lève un nouvel impôt pour l'entretien du lactoduc devenu inutile.
** Vous avez un concept de vache, vous trouvez des financements pour un projet de site internet hyper tendance, dans le mood de la nature at home qui consiste à vendre une vache virtuelle à un internaute, qui peut la voir se mouvoir pesamment et grandir grâce à une webcam. Le projet tient bon, vous pouvez vendre la même vache à 10 000 personnes, en anglais, français et japonais. Vous vous procurez deux vaches en échange de stock options... Les financements affluent, la stagiaire qui s'occupait des vaches se barre à Malaga avec le ouabmaster. Vous vous effondrez dans les bras de Stephane Bern et vous partez aux îles Caïman avec les financements. Les vaches meurent de faim.
**Mes vaches sont élucidantes à partir de ce fait que celui qui me comprend les reconnaît à la fin pour des non-taureaux, si, passant par elles, sur elles, par-dessus elles, il est monté pour sortir de l'enclos. Il faut qu’il surmonte ces vaches ; alors il acquiert une juste vision de la ferme.%%%µµ(L. Wittgenstein, Le Tracteurus moissono-philosophicus, prop. 6,54)µµ
* µµLongtemps, je me suis couché de bonne heure. Parfois, à peine ma bougie éteinte, mes yeux se fermaient si vite que je n'avais pas le temps de me dire : Je m'endors. Et, une demi-heure après, la pensée qu'il était temps de chercher le sommeil m'éveillait ; je voulais poser le volume que je croyais avoir encore dans les mains et souffler ma lumière ; je n'avais pas cessé en dormant de faire des réflexions sur ce que je venais de lire, mais ces réflexions avaient pris un tour un peu particulier ; il me semblait que j'étais moi-même ce dont parlait l'ouvrage : une église, un quatuor, la rivalité de François Ier et de Charles-Quint.µµ%%%Note de l'édition 1952 : %%%''Le texte exact du manuscrit retrouvé depuis la 1ère édition était :%%%"une église, __une vache__, un quatuor, la rivalité de François Ier et de Charles-Quint".%%%Il n'a par contre jamais été écrit "je voulais poser la vache que je croyais avoir encore dans les mains"''
ListeRohmer
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Les Rendez-vous de Paris (1995)
ListeOriginaleDeCeluiQuinAimePasLesSmileys
/* par PITIE ne mettez pas de liens vers de GROS smiley images. merci
*Rappelons d'autre part qu'il est rigoureusement interdit de placer des smileys dans un four à micro ondes.[http://pagesperso-orange.fr/lemomo2/microonde.gif]
* parler fort pour que tout l'monde écoute dans le troquet
* donner le mode d'emploi de ses propos parce qu'ils ne se suffisent pas.
* mais c'est comme tout, si on en abuse pas, c'est parfaitement supportable.
/* je m'suis autorisé à extraire vos smileys de ma complainte pour les remettre un peu plus bas, comme si vous y alliez d'une nasarde en fin de tirade, et non comme si vous me coupiez la parole, mais vous ferez ce que bon vous semble :-) df
ListeDeCelebritesDontLeNomEstUnPrenom
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(µpar alpha s'il vous plait sinon on va s'y perdre - et il n'est pas interdit d'illustrer avec des photos de b__%%Red(OO)%%__nnes actrices !µ)%%
*Capar David Friedrich ( peintre allemand)
*Jacky Bernard '' µAh ! L'audition de Jacky Bernard, par Fernand Raynaud, un must, un perleµ''
* Le Paris St Germain (et la purée du même nom)
ListeQuestionnaireDeMarjorie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*** Parce que chez toi t'aimais bien ?
** La question me paraît assez complexe. Pour aller vite, la loi reflète les principes moraux d'une société, et l'état s'adapte à l'évolution de ces mêmes principes.
** Oui ! Interdisons la moralité et on en parle plus !
** Non car la morale n'est pas une science exacte... par contre garantir certains principe fondamentaux, oui !
** Non parce que j'en serais bien incapable parfois
** Oui, parfois.
** Oui, parce que tout n'est pas à jeter
** Pour faire la part des choses, quand on arrice à la faire
** Tout, non ! Cela dit on accepte bien de faire deux heures de transport par jour et un travail idiot, tout ça contre un peu d'argent !
** NON NON NON NON NON NON NON NON mais il paraît que si
** Oui, mais c'est parfois difficile d'accès
# Peut-on condamner un acte commis consensuellement et réciproquement par deux personnes majeures ?
** Non, par principe !
** Oui, ça fait du bien parfois de lâcher le cordon
** Les chats, parce qu'ils sont plus libres
** Le chat, parce que l'affection d'un chat, ça se mérite...
** Non, et d'ailleurs je commande rarement, si ce n'est parfois un plat au restaurant...
** Beaucoup. En particulier lorsque je me sens dominé.
** Oui... personne n'est parfait
# Vous arrive-t-il d’être fasciné par des choses qui symbolisent ce que vous n’aimez pas ?
** Oui, parce que j'aime bien les petits drapeaux.
** Ben oui, personne n'est parfait
ListeDePrenomsFemininsLesPlusMoches
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Adèle µµElle est morte Adèle, tuée par un sale ami, il n'y a pas que des gens bons !...- c'est la vie... la vie d'Adèle, évidemment !µµ
* Berthe (elle est experte) µµsans parler de ses pieds... -- ''son pied'' en fait, c'est singulier.µµ
* Lydia ( je sais de quoi je parle, je me traîne ce nom depuis plus de 30 ans)
* Porcaire (sisi, encore un prénom légalement autorisé par la loi du 11 germinal an XI)
(je sens ça vous intrigue, pour une liste d'[autres noms aussi improbables|http://www.topito.com/top-20-des-prenoms-improbables-autorises-par-la-loi-du-11-germinal-de-lan-xi])
* Arsule, par chance, n'existe pas encore
PS : Zavez-vu ? J'ai complété pour qu'il y en ait qui commencent par toutes les lettres de l'alphabet. Quel raffinement... Kindofblue (le enième retour)
ListeDesChefsDetatsFrancais
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# __Chlodion ou Clodion__, (v395-v447), chef des Francs saliens (v426-v447), ''historicité douteuse, par ailleurs les Francs saliens n'occupaient à l'époque que deux petites régions à l'extrême Nord de la France et de la Belgique actuelle''
# __Thierry 1er__ (v485,490-534) roi de Reims (ou de Metz) 1er Partage (Austrasie) - (511-534)
# __Childebert 1er__ (511-558) roi de Paris
# __Théodebert 1er__ ou Thibert (534-547-548) Austrasie ''Mortellement blessé par un bison pendant une partie de chasse''
# __Théodebald 1er__ ou Thibaud (547-548-555) Austrasie ''Excommunié par l'évêque de Paris pour avoir choisi en quatrième noce, une religieuse'' Thibilde.
# __Caribert__ (561-567) 1er partage Paris
# __Chilperic 1er__ (561-584) Neustrie, Paris, ''meurt assassiné''
# __Gontran__ (561-592) Orléans, Bourgogne, Paris
# __Clotaire II__ (584-629) Neustrie, Paris, roi des Francs
# __Childebert II__ (575-595) Austrasie, Paris, Bourgogne depuis 593 - ''probablement empoisonné, par sa tante Frédégonde''.
# __Dagobert II__ (676-679) Austrasie ''assassiné pendant une partie de chasse, canonisé sans qu'on sache vraiment pourquoi''
# __Childebert III__ (691-695) Neustrie, ''Assassiné lors d'un guet-apens avec son épouse par Bodilo''
# __Clotaire IV__ (717-719) désigné par Charles Martel Austrasie
# __Chideric III__ (743-751) roi des Francs - ''Déposé par Pépin le bref, il finira ses jours enfermé dans un monastère''
# __Charles II le Chauve__ (né en 823) (843-877) Roi de France et Empereur d'Occident. ''Il n'était pas chauve du tout mais avait cru malin de se raser le caillou (en signe de soumission à l'Eglise) lors de la consécration d'un édifice religieux par le pape Jean VIII.'' En 846 Charles le Chauve se voit contraint de reconnaitre __Nominoë__ comme souverain de la Bretagne.
# __Charles III le simple__ (893-922) avec Eudes jusqu'en 898 ''(il y a donc 2 Charles III dans la liste) - Déposé en 922 par "les grands du royaume" au profit de Robert 1er. Fait prisonnier en 923 après la défaite de Soissons. Meurt en détention en 929.''
# __Raoul__ (923-936) famille capétienne ''meurt d'une infection provoquée par des poux !''
# __Philippe 1er__ (1060-1108), ''L'un des plus long règne de l'histoire de France. Souvent ridiculisé militairement par ses puissants vassaux. Excommunié par le concile d'Autun en 1094 pour bigamie.''
# __Philippe II Auguste__ (1180-1223) ''Incapable de consommer son mariage avec Ingeburge de Danemark, il la fait accuser de sorcellerie et enfermer. Il fait annuler le mariage par des évêques à sa solde et épouse Agnès de Meranie. Le pape s'en mêle et le roi fait machine arrière, mais ne libère pas pour autant Ingeburge qui ne sera libérée que 20 ans plus tard quand il devra faire alliance avec le Danemark pour repousser Jean sans Terre''
# __Louis X le Hutin__ (1314-1316) ''mort à 27 ans, ne régna que 18 mois, mais trouva le moyen de faire pendre les ministres proches de Philippe le Bel, tel Enguerrand de Marigny. Déclarera la guerre au comte de Flandre. Tombe malade après voir bu un verre de vin glacé après une partie de jeu de paume et meurt ! - Hutin signifie bagarrreur -''
# __Louis XI__ né en 1423 (1461-1483) ''A 14 ans il fait la guerre et gagne une bataille, il demande et obtient de ses parents la permission de pouvoir déflorer sa femme Marguerite d'Ecosse. A remarquer que Louis XI, personnage qui ne s'embarrassait pas de principe et qui faisait parfois preuve d'une insoutenable cruauté était aussi un bel exemple d’hypocrisie, père la morale pour les autres... et zoophile en privé.''
# __François 1er__ (1515-1547) '' Protecteur des arts et des lettres (c'est bien) grand constructeur de châteaux (Amboise, Blois, Chambord), belliqueux impulsif et médiocre stratège, il ruinera la France. En 1532, l'union du duché de Bretagne et du royaume de France est proclamée. Fait prisonnier à Pavie (Italie) en 1524 par les troupes de Charles Quint, il ne sera libéré qu'en 1526. Se sentant menacé par les idées luthériennes, fait interdire toute impression de livres. Il annule sa décision quelques jours plus tard mais conserve le principe de la censure qu'il confie à une commission du parlement de Paris. Sous son règne on torturera et on brûlera des imprimeurs en place publique, notamment Etienne Dolet en 1546. ''
# __Charles IX__ (1560-1574) ''En 1564, Charles IX, alors âgé de 14 ans, signe l'édit de Roussillon, fixant le 1er janvier comme premier jour de l'année pour l'ensemble du royaume. L'application en sera effective à partir de 1567. Son rôle dans le massacre de la St-Barthélémy (24 aout 1572) n'est pas clair, il aurait ordonné le massacre pour ne pas contrarier maman (Catherine de Médicis) et le remord l'aurait rendu fou. Mort à 24 ans de la tuberculose.''
# __Henri III__ (1574-1589) ''mort assassiné, poignardé sur sa chaise percée par le moine Jacques Clément.''
# __Henri IV__ né en 1553 (1589-†1610) '' Le vert galant, atteint de priapisme, il a collectionné les maîtresses d'un jour mais savait pourtant s'attacher (Gabrielle d'Estrées). Bel exemple de réalisme politique il n'hésita pas à alors qu'il était protestant à se convertir au catholicisme (Paris vaut bien une messe). Mort assassiné, poignardé dans son carrosse à l'arrêt par François Ravaillac'' [http://www.vialupo.com/henri4/images/vert-galant.jpg]
# __Louis XIII__ né en 1601 (1610-†1643) ''Il se marie à Bordeaux. Sur les 3000 hommes de son escorte surpris par le froid, un millier meurt sur la route. Austère, on ne lui connait aucune favorite (il considérait les femmes comme frivoles et vicieuses.) Il était peut-être homosexuel, voire asexuel''
# __Louis XV__ né en 1710 (1715-†1774) ''Interdit l'impression et la diffusion des deux premiers volumes de "L'Encyclopédie" de Diderot et d'Alembert (jugée subversive par les Jésuites) Faillit être assassiné par Damien en 1757. Mort de septicémie''
# Consulat :__Napoléon Bonaparte__ (1769-†1821) (1799-1804), premier consul après un coup d'État, consul à vie en 1802, empereur en 1804.
# __[Napoléon 1er|ListeDePhrasesJamaisPrononceesParNapoleon]__ (1769-†1821) (1804-1814) et 100 jours en 1815. ''Déporté par les anglais à l'ile de Sainte-Hélène en 1815, il décédera en 1821 (Cancer ? Empoisonnement ?) Admiré par son génie militaire, sa folie de conquête a ruiné la France, il est d'autre part responsable du rétablissement de l'esclavage et du "code noir"'' [http://4.bp.blogspot.com/_KRnfUFHNcdw/SBOsDwnHvZI/AAAAAAAABF4/zdyvaaldWos/s400/AAAAAAAAAAAA+echecs.jpg]
# __Louis-Napoléon Bonaparte__ (1808-†1873) (1848-1852) neveu de l'autre Napoléon.
# __Napoléon III__ (1852-1870) ''(le même que précédemment mais changement de titre et de nom) - Fait prisonnier par les prussiens à Sedan, dans les Ardennes en 1870.'' [http://www.deutsche-schutzgebiete.de/webpages/napoleon3+.jpg]
# __Adolphe Thiers__ (1797-†1877) (1871-1873) ''Bourreau de la commune de Paris (25.000 morts) - Démissionna sous la pression des monarchistes''
# __Patrice de Mac-Mahon__ (1808-†1893) (1873-1879) ''Monarchiste et partisan de l'ordre moral. Démissionna. (Roselyne Bachelot de l'époque, puisque, en déplacement à Toulouse après des inondations, il s'était exclamé : "Que d'eau, que d'eau !") µµpourquoi omet-on toujours son prénom et sa particule à celui-ci ?µµ''
# __Marie François Sadi-Carnot__ dit Sadi-Carnot) 1837-†1894)(1887-1894) ''poignardé à mort par l'anarchiste italien Sante Caserio''
# __Félix Faure__ (1841-†1899) (1895-1899) ''mort par épectase à l'Elysée dans les bras de [Marguerite Steinheil|ListeDeFemmesIntrigantes]''. ''µ(Il voulut être César, il ne fut que Pompée)µ''
# __Emile Loubet__ (1838-†1929) (1899-1906) ''Sous son septennat, le capitaine Dreyfus fut gracié, et la loi sur la séparation des Églises et de l'État fut promulgué provoquant la fureur du Vatican.''
# __Paul Doumer__ (1857-†1932) (1931-1932). ''Assassiné par Paul Gorgulov, un immigré russe un peu dérangé''.
# __Alain Poher__ (1909-†1996) ''Président de la République par intérim à deux reprises. Une première fois après la démission de Charles de Gaulle du 28 avril 1969 au 20 juin, lorsqu'il assure avec Georges Pompidou (qui l'a battu au second tour de l'élection présidentielle), la cérémonie de passation de pouvoirs. Puis une seconde fois, du 2 avril au 24 mai 1974, après la mort de Pompidou''.
# __Nicolas [Sarkozy|ListeDeSarkozy]__ (né en 1955) (2007-2012) ''Commence son septennat par un geste fort... il s'en va bouffer dans un restaurant pour rupins. Divorce et se remarie (pour la seconde fois) en cours de mandat.''
* Cinq chefs d'état ont été fait prisonniers par l'ennemi à l'issue de batailles militaires ! Sauriez-vous les retrouver ? Sinon la solution est [ici|ListeDeSolutionsDesJeux] (solution n°2)
ListeDesElementsChimiques
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Ouais ? L'intérêt ? On trouve ça partout ([par exemple là|http://fr.wikipedia.org/wiki/Tableau_p%E9riodique_des_%E9l%E9ments] ou [plus joli|http://www.periodictableonline.org/archi.htm]).
ListeDeCeQueJaiDecouvertAvecEcholalie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* quelques __abrutis__ (hélas, il y en a partout...)--DES NOMS !
* l'ordre __alphabétique__, en particulier le B-A BA
* les ''__e__'' dans ''La disparition''
* Pas mal de __liens intéressants__ (par contre, il y en a... je ne vous en parle même pas...)
* Le plaisir de __participer__ à un site avec beaucoup d'autres anonymes
* Que tous les jours je parlais en __prose__...
* que je ne suis pas le seul à exécrer les __4x4__, les conducteurs de __4x4__, et la façon de conduire des conducteurs de __4x4__ (à Madagascar seulement ou partout ?)
µµreclassé par Sosthène
ListeDesGagnantesDuVargling
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
#''voici des précisions'' : La première épreuve européenne de Vargling ne réunit que dix candidates, le concours se déroula de façon assez confidentielle dans une petite bourgade des bords de la Moselle et fut remportée par la ravissante Belge de Namur, __Tatiana__ en mai 1985. (le nom de ''Sheila Chatenfeu'' cité sur un certain site n'étant que pure invention)%%%En mai 1997, le 313ème concours organisé et remporté par l’allemande __Tiziana Redford__ (Gina Colany) à Barcelone (un certain site donne comme vainqueur une certaine ''Gretchen Devello'' qui n'existe évidemment pas) devait être le dernier, la pléthore de candidates (plus de 750) rendant les épreuves ingérables. Il y eu malgré tout une 314ème épreuve, en décembre 1997, organisé par le Vargling Club de Budapest, et qui devait consacrer le triomphe de __Patricia III__. Ce concours placé sous le signe de Pythagore devait marquer le point final de cette aventure qui nous a passionné pendant 12 ans.
# l'acharnement d'un censeur (''sans doute influencé par les américains horrifiés par le sein de Janet Jackson'') s'acharnant à effacer une illustration très soft de Draghixa et qui constituait le seul intérêt de cette liste pour le lecteur lambda décidemment fait pitié
# Un début de réponse : Un recherche de ''Vargling'' sur Google, m'a mis en première position, un site en suédois (?) incompréhensible, par contre les autres ont des noms de domaine assez suggestif :
*** tous les liens cités dans ce paragraphe sont obsolètes.
# Apparemment le vargling n'a rien à voir avec le gonglage, malgré une vague assonance.
# sans image µµje ne suis pas le censeurµµ cette liste ne manque pas d'un charme étrange et indéfinissable; en particulier la césure entre 284 et 285 me pose un profond questionnement.
# Les spécialistes auront remarqué qu'un joyeux ''primesautier'' --µêtes vous bien sûr de l'orthographe et du sens de primesautier ?µ--a placé en 6ème position de la 51e épreuve, [Antoinette|http://www.echolalie.com/l139.htm] de Gabolde d'Audan, rendons donc à Véronique de M ce qui n'appartient qu'à Véronique de M, c'est à dire la 6ème position de la 51e épreuve.
# On remarquera d'autre part la présence aux côtés de parfaites inconnues de
# [ici|http://lassilia.voila.net/DicoquinV.htm] une définition. Mais la liste perd tout son mystère. -- mais non ! -- Enfin, voici :%%%µµShow érotique que deux participantes exécutent en même temps mais en concurrence, à son terme, elles sont départagées par le jury, ou par le public. La chose est beaucoup moins évidente qu’il n’y parait, chacune ayant constamment un regard sur l’autre. On peut y introduire des contraintes, interdire (ou obliger) certains gestes. Très à la mode dans des soirées privées ou semi publiques, dans les années 1980 le mot fut inventé par un libertin très connu mais dont nous tairons le nom.µµ
Liste participante à la ListeDeListesListantDesMotsIntrouvablesDansLesDictionnairesUsuels
ListeDeChansonsQuiContiennentUnMois
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
« Et loin de nos villes / comme octobre l'est d'avril / sache qu'ici reste de toi / comme un empreinte... / indélébile » (Jean-Jacques Goldman, "Puisque tu pars")
*Avril - Paris Combo
*En avril à Paris - Charles Trenet
*J'aime Paris au mois de mai - Charles Aznavour
*Paris mai - Claude Nougaro
*Le mois d'août à Paris - Camélia Jordana
*Paris au mois d'août - Charles Aznavour
*Paris, 15 août - Barbara
ListeOfficielleDuPartiDesOurs
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(__Liste officielle du parti des Ours__)%%
*Boubou, adjoint aux parcs naturels et secrétaire du ministère de l'aide à l'insertion des personnes de petite taille
µµ"Par le corps de saint Gilles ! s’écrie l'ours, Renart, d'où vous vient tout ce miel ? C'est la chose du monde la plus délectable à mon pauvre ventre. Menez-y-moi, beau très doux Sire, pour Dieu, mea culpa ! De l'avoir si tôt berné, Renart ne se sent plus de joie."(extrait du "roman de renart")µµ
*Yogi, ministre des parcs naturels[http://www.minicita.com/bd_w/images/d0510.jpeg]
ListeDeHistoiresDeListes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Chapitre [Zéro|HistoireDeListes] - Chapitre verrouillé par le webmaster
* Chapître [I|SuiteDeHistoireDeListes] - Chapitre verrouillé par le webmaster
* Chapître [II|SuiteDeHistoireDeListesDeux] - Chapitre verrouillé par le webmaster
ListeDesBonnesRepliquesDeCinema
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(µµclassées par annéesµµ)%%
**César (Raimu) : - Quand tu me parles sur ce ton, quand tu m'espinches comme si j'étais un scélérat, et bien tu me fends le cœur !
**- Tu me prends pour un imbécile ? Tu as dit : "il nous fend le cœur" pour lui faire comprendre que je coupe à cœur. Et alors il joue cœur, parbleu ! Tiens, les voilà, tes cartes, tricheur !
* __Compartiment de dames seules__ (Christian-Jacque - 1934)
**- Les libellules sont en folie / Pour elles, point de mélancolie / Elles se livrent aux pires orgies... µ''chanté par Ginette Leclerc''µ
** - Je vous félicite mon ami, vous travaillez vite et vous ne faites pas trop de saletés par terre. Qu'est ce qu'on peu demander de plus à un peintre ?. ''µ(Le bourgmestre s'adressant à Rembrandt).µ''
** A force d'écrire des choses horribles, les choses horribles finissent par arriver. µ''Michel Simon''µ
** - Tu ferais un excellent critique. Tu parles fort bien de ce que tu connais mal...
** - Oui. Parce qu'elle impressionne les imbéciles. ''µLouis Jouvetµ''
*__La traversée de Paris__ (Claude Autant-Lara - 1958)
**- St Léonard, ayez pitié de lui !
**- En langage clinique, on appelle ça un paranoïaque, en langage militaire un brigadier. µ''Maurice Biraud et Charles Aznavour''µ
** Patricia, mon petit... Je voudrais pas te paraître vieux jeu ni encore moins grossier. L'homme de la Pampa parfois rude reste toujours courtois mais la vérité m'oblige à te le dire : ton Antoine commence à me les briser menues ! µ''Lino Ventura''µ
**- Vous savez, quand un monsieur inconnu ramène chez vous votre mari mort, dynamite la salle de bains et jette les visiteurs par la fenêtre, on prend l'habitude de ne plus s'étonner de grand'chose... µ''Mireille Darc''µ
** - Oublie le mot dessin, chéri, il est complètement anachronique, parle de graphisme, de modelé, ou de mise en condition de l’objet, je préfère… et puis… n’emploie jamais non plus le mot de coloris mon amour,… parle de chromatisme, de matité, de rythme. µ''Irina Demick''µ
**- Mes parents sont des proxénètes de l'honnêteté... J'ai été bourrée de morale comme d'autres sont gavés de Blédine... Une morale à eux, bien sûr. ''µMireille Darcµ''
**- Chez nous, ça moutonnait... À bloc... Le trio Mérinos... Et toujours avec citations à l'appui, 'Mon verre est petit, mais je bois dans mon verre'... 'Chi va piano va sano' ... 'Santé passe richesse'... 'La vie' ... Ch'ais plus c'qu'était la vie selon Pépère, mais ça devait être bien !... Et puis, j'ai rencontré un homme qui, lui aussi, parlait de la vie. Seulement c'était pas la même. Lui, c'était plutôt 'Mon verre est petit, mais je bois dans c'lui des autres'...'' µMireille Darcµ''
*__The Party__ (Blake Edwards - 1968)
**- Quand on parle pognon, à partir d’un certain chiffre, tout le monde écoute. ''µJean Gabin à Dany Carrelµ''
** - La bagarre, c'est pas là, c'est plus loin par là sur la gauche...''µJacques Jouanneauµ''.µµCette réplique est parfois attribué à tort à Jean-Paul Belmondo dans "Pierrot le fou".µµ
**- Mais non, j'te parlais de la balle ! ''µBud Spencerµ''
*__Le dernier tango à Paris__ (Bernardo Bertolucci - 1972)
**- Pour une partouze, il faut être au moins six ; si le nombre est inférieur, il n'y a que des rapports sentimentaux.
*__Le parrain__ (Francis Ford Coppola - 1972)
** - Toi, pas faire partie de la file indienne, toi visage pâle ! µ''Un indien''µ
**- Il y a des vipères qui servent parfois à bouffer des vieilles taupes nuisibles ! µ''Jean-Marie Pallardy''µ
** - On est pas bien là ? Paisibles, à la fraîche, décontractés du gland, et on bandera quand on aura envie de bander… µ''Gérard Depardieu''µ
**- Il parait qu'en Italie ceux qui font pipi au lit. on leur coupe&#65279; leur zizi pour en faire des spaghettis ! µ''Vittorio Gassman''µ
**- On commence par voir des soucoupes, et on finit par voir des rats se balader sur l'édredon ! µLouis de Funèsµ''
** - On vous demande de répondre par oui ou par non, Forcément "ça dépend", ça dépasse... µ''Christian Clavier''µ
**- J'aurais dû être chirurgien esthétique ! 500.000 dollars par an pour m'occuper de [nichons|ListeDeCitationsEtrangeresSurLesSeinsEtAutresMamelles] et de fesses !
** - Ça sent la fraude fiscale ! µ''Gérard Depardieu''µ
** - Les serrures, faut que ça mouille, c'est comme tous les orifices... ! µ''Gérard Depardieu''µ
** Je vais te le cambrioler ton cœur. Ton cœur et puis tout le reste. Je vais m'introduire et tout piquer. µ''Gérard Depardieu à Michel Blanc''µ
** Regarde-toi dans mes yeux, tu vas te trouver sublime. µ''Gérard Depardieu''µ
** Je veux vous voir baiser ma femme, un par devant, un par derrière, et pendant ce temps là je vous enculerai ! µ" Jean-Pierre Marielle à Gérard Depardieu et à Michel Blanc''µ
**- Rien dans les écritures n’établit que notre seigneur n’ait pas rit. On sait que les saints eux mêmes usaient de la comédie pour ridiculiser les ennemis de la foi. Par exemple, Quand les païens mirent Saint Maur dans l’eau bouillante, celui-ci se plaignit que le bain était trop froid, le sultan y plongea les doigts et s’ébouillanta la main.
**- Dis moi un nom d’une personne qui soit parti de rien et qui ait trouvé le grand Amour ? µ''Julia Roberts''µ
**- Si vous faites encore du mal aux putains je reviendrai et je vous tuerai tous, salopards ! µ''Clint Eastwood)''µ
**-Jacquouille ! Passe moi la [gourdasse|ListeDeVocablesPasTropSympasSeTerminantParAsse], j'ai grand soif ! µ''Jean Réno s'adressant à Christian Clavier''µ
**- Faire minette à une nana ou lui masser les pieds c'est pas pareil ! µ''Samuel Jackson''µ
** - De toute façon, elle se faisait culbuter par tout le monde !
**- Ecoute-moi bien ma chérie, pourquoi t'allumerais pas la mèche de ton tampax pour te faire exploser la tirelire ? Parce que toi c'est bien le seul moyen que t'auras jamais de te faire sauter... µ''Terence Stamp''µ
**- Non, sérieusement, tu veux savoir pourquoi je t'ai bien aimé d'entrée ? Parce que j'ai toujours été attirée par les losers. µ''Mira Sorvino''µ
**- Oui, tu manques d'assurance ; je trouve ça chou chez un homme. Je supporte pas les clients qui entrent ici, jettent leurs 200 $, sortent leur grosse queue et la font parader dans toute la pièce. µ''Mira Sorvino''µ
*__Evita__ (Alan Parker - 1996)
**- Les composants... Les composants américains ou russes, c'est pareil, c'est tous "made in Taiwan" !
** - Et bien lui c’est pareil, c’est Just. ''µThierry Lhermite et Jacques Villeretµ''
** - Elle est morte, elle ne sera plus jamais pareille ! µ''Emily Watson''µ
**- Toute la journée, Môssieur vend des poireaux et le soir il dessine des navets. Qu'est-ce que vous voulez que je fasse d'un légume pareil ?
**- C'est bon ces grosses crevettes là. ! ''µDepardieuµ''
**- Obélix ! ''µDepardieuµ''
**- Ma pauvre Louise, votre parole n'a aucune valeur, vous n'êtes qu'une bonne ! µ''Fanny Ardant''µ
**- Ma pauvre Pierrette, votre parole n'en a pas plus, vous n'êtes qu'une putain ! µ''Emmanuelle Béart''µ
**- Toi tu vas ta gueule fermer ! µ''Gérard Depardieu''µ
**- Tout s’achète : l’amour, l’art, la planète Terre, vous, moi... Surtout moi. L’homme est un produit comme les autres. Avec une date limite de vente. Je suis publicitaire. Je suis de ceux qui vous font rêver des choses que vous n’aurez jamais. Ciel toujours bleu, nanas jamais moche, bonheur parfait retouché sur Photoshop. Vous croyez que j’embellis le monde ? Perdu, je le bousille.
**- D'accord et comment vous appelez un pays qui a comme président un militaire avec les pleins pouvoirs, une police secrète, une seule chaine de télévision et dont toute l'information est contrôlée par l'état ?
**- Les chiens, les chats ! Putain, mais tout le monde parle comme vous ici ?
**- Ah, ben ouais, chez les Ch'timis, tout l'monde y parle ch'timi, hein ! µ''Kad Merad et Dany Boon''µ
** -Des vampires lesbiennes ? La prochaine fois, je me ferai peut-être sodomiser par un loup-garou homo !
**- Quand même, pute, c'est presque de la prostitution ?! µ''Julie Depardieu''µ
**Play it again, Sam.. µ(là faudrait expliquer... Hé ben, c'est Bogart qui demande au pianiste de rejouer le morceau, As tears go by je crois, sur lequel il a rencontré Ingrid Bergman à Paris, la nostalgie tout ça...) - euh ! mon souvenir, c'est plutôt, Play it, Sam (Play It Again, Sam est le titre d'un film de Woody Allen, faisant évidemment référence à Casablanca) et c'est Ingrid Bergman qui le demande à Dooley Wilson, à Casablanca, en souvenir, effectivement, de sa rencontre avec Bogart à Paris. Le morceau, là j'en suis sur, c'est As Time Goes By, et je ne peux pas l'entendre sans frissonner... avec tout ça, la citation peut remonter dans la liste après correctionµ
* En ce moment, je parierai que tu t’imagines déjà en train de sucer ma bite au rythme des coups de fouet de mes couilles sur ta gueule
*des [beaucoup plus affligeants (et parfois anonymes ici|ListeDeDialoguesAffligeants])
ListeSubliminaleNumeroDeuxBis
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListedesDisquesQuOnPossedeMaisQuOnAhonteDePasserAuxAmis
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* ''Da Dou Ronne Ronne'' par Johny Halliday
* ''Ya Mustapha'' (1960) par Bob Azam et aussi ''Fais-moi du couscous chéri'' (1960)
* ''La petite Marie (elle fait le couscous)'' par Les Musiciens 1969
* ''Et j'entends siffler le train'' par Richard Anthony
* ''Si tu vas à Rio'' par Dario Moreno
* ''Docteur Miracle'' par Annie Cordy
* ''Il faut danser reggae'' - par Dalida (eh oui. Elle a osé. [La preuve par Youtube|http://www.youtube.com/watch?v=bxb371CV4no])
* ''Heureusement y'avait Fanny'', par Hughes Aufray
* ''Fleur de Province'' par Charlotte Julian
* ''Viens boire un p'tit coup à la maison'' par Licence IV
* ''Le Professeur de gymnastique'' par Fernand Raynaud
* ''Ma Cabane au canada'' par Line Renaud
* ''Etoile des Neiges'' par Line Renaud
* ''I'm watching you'' par Syvie Vartan
* ''Chariot'' par Pétula Clark
* ''Maman a tort'' par Mylène Farmer
* ''Le Big Bisou'' par Carlos
* ''Le Twist du canotier'' avec Maurice Chevalier accompagné par Eddy Mitchell et les Chaussettes Noires
* ''Hava Nagila'' par Rika Zaraï
* ''Riquita'' par Georgette Plana
* Les chansons de mon enfance par Dorothée
* ''Le [Zobi|http://www.chez.com/tital/chansons/ch9.html] d'Ali Pacha'' par les Crévaindieu
* ''La casa d'Irène'', par Sacha Distel
* ''Gigi l'amoroso'' par Dalida
** ''Marches et [Chants|http://www.troupesdemarine.org/outils/disco/fiches/cd000122.htm] de la Légion Étrangère''µµparce que c'est pas vrai, vous ne pouvez pas avoir ça %%Red(chez vous)%% ?
ListeDeGentillessesEcritesParCertainsWikistes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(__LISTE DE GENTILLESSES ECRITES PAR CERTAINS WIKISTES__)%%
* 8,6 et XX, bières (la seconde, sous le nom développé de Dos equis, sévit également au Mexique, mais là-bas, c'est de la supérieure - pas comme la Corona, réservée aux __ânes__ et au __Amerlopes__ ! - ainsi qu'au __plus grand voleur de France__, durablement protégé par la divine providence (avec l'aide d'un __gangster complice__, chaussé par Elf et par Berluti))
*...d'une façon plus générale, dénigrer les succès consensuels qui nous font l'effet de criantes impostures, comme "La vie est belle" de Roberto Benigni (un __abominable chantage__ à l'émotion filmé par des bras cassés), "Amélie Poulain" (__guimauve publicitaire sur fond de carte postale pétainiste__), les œuvres complètes de Daniel Pennac (__polars mièvres__ à destination des associations de parents d'élèves), le guide du routard, etc. etc. (tiens ça pourrait faire une nouvelle liste ?)
*''Les gens toujours pressés et qui dérangent ceux qui se laissent porter µcomme __des gros tas de semoule__, indifférents à la gène qu'ils causentµ par les escalators (c'est quoi un convoyeur à bande ?)''
* Au final : µPar faveur exceptionnelle, __les béotiens et les demeurés__ pourront continuer à dire ''à la fin'', comme avant.µ
* Au quotidien : µ__Ânerie__ apparue il y a quelques années et désormais ''incontournable'' Destiné à permettre aux __débiles et à leurs admirateurs__ d'éviter le trop roturier ''tous les jours''.µ
**µDevons-nous comprendre qu'il est souhaitable, voire nécessaire, d'imiter les __histrions qui plastronnent dans le poste__, pour paraître aimer nos semblables ?µ
* Carton jaune : µAussi __con__ que le précédent µ(avant la mise en ordre alphabétique de la liste)µ. Inspiré par le football, ce qui permet de situer le niveau.µ
* C'est tendance : µC'est un nouvel impératif catégorique : si vous êtes amené, professionnellement ou de manière occasionnelle, à vous exprimer à la radio ou à la télé, vous devez entamer au moins une phrase sur deux par __cette horreur__ !µ
* Effectivement : µTrès employé par les __doctes qui s'écoutent parler__µ
* ''Elle est pas belle la vie ?'' : µGrossière provocation vraisemblablement lancée par les __nantis__ qui tiennent l'assiette au beurre et la télé pour humilier un peu plus les __cons qui leur bouffent dans la main__ en se pâmant devant la Star'Ac et les déclarations racistes et xénophobes dont Jean-Marie n'a plus le monopoleµ
* Julia Kristeva ? µUne imposture majeure ! __Elle a chié__ au poids une thèse (sic) de linguistique qui établissait au mieux qu'elle n'avait rien compris aux travaux de Frege, Gödel, Russell et Zermelo, et qui lui a valu aussitôt une chaire à l'Université de Paris, attribuée par d'autres __ignorants mondains__, ce qui lui permet depuis lors de plastronner ex-cathedraµ
** Les bananes vous remercient, et par ailleurs, quel est le bon choix ?
*liste concocté par Sylvain qui en a marre de ceux qui n'ont que la haine au cœur. Réservons notre haine pour ce qui en vaut la PEN !
*** Mouchez-vous avant de m'adresser la parole !
*** Bonjour, je suis nouvelle, je m'appelle Marie-Noëlle (de Paris); qui veut m'aider? c'est un peu technique le ouisqui hihhi
* Un ajout vient d'être effacé, non pas parce qu'il y a des censeurs sur ce site, mais parce que le contributeur est tellement à l'Ouest qu'il place son truc n'importe où ne se rendant même pas compte qu'il coupe en deux un paragraphe composé d'une réflexion et de sa réponse. Cet ajout s'assimile donc à un acte de sabotage.
ListeDesJuronsDuCapitaineHaddock
/* par PITIE ne mettez pas de liens vers de GROS bachibouzouk. merci
* accapareur
* paranoïaque
* parasite
* et parfois il reste sans voix[http://pagesperso-orange.fr/lemomo2/Tibet2.jpg]
* body-snatchers (la vignette ci-dessous est celle de l'édition anglaise, le mot trompe-la-mort a été traduit par body snatcher. (on a aussi retiré le e final de vandale) En français, Haddock n'a jamais traité personne de body-snatchers. [http://www.tintinmilou.free.fr/images/haddock1.jpg]
ListeDeFromages
/* par PITIE ne mettez pas de liens vers de GROS fromages. merci
* Je prends tous les jours le remède que l'incomparable Dickens prescrit contre le suicide. Cela consiste en un verre de vin, un morceau de pain et du fromage, et une pipe de tabac. ''Vincent Van Gogh'' --µµpourquoi precise-t-il "de tabac" ?µµ
* Qu'advient-il du trou lorsque le fromage a disparu ? ''Bertolt Brecht''
** µRecette : récupérez des vieux bouts de fromage auxquels même les rats n'osent plus toucher, râpez tout ça, malaxez avec les épices que vous trouverez, confectionnez-en un cône d'angle assez aigu, laissez macérer encore quelques mois dans de la gnôle à refroidir un légionnaire polonais, passez au minium, mangez - vous considérerez désormais le ''munster'' comme une variété particulièrement fade de ''Vache-qui-rit''.µ
*Chabichou µ(je vous dis pas si l'[agitée|http://www.echolalie.org/wiki/index.php?ListedeSegol%E8nes] est élue, on va en entendre parler...)µ
*Parmesan µ(''parmigiano'' en VO)µ
*Pizza à la tartiflette µ(c'est une préparation à base de reblochon, non un fromage)µ
ListeDeChateaux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Château de la Belle au Bois dormant [http://perso.wanadoo.fr/therese.eveilleau/pages/paradoxe/images/castle.gif]
* Château-rouge (station de métro de la ligne 4 à Paris)
*[voir aussi ces quelques pinards|ListedeVinsRougesDontLeNomCommencentParChateau]
ListePreparatoirePourLePrixGeorgesBrougnard
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
Le prix Georges Brougnard est décerné par l'Association Echolalie (vote secret de l'AG) à la plus belle liste trouvée dans le wiki Echolalistes. Cette liste est récompensée et décorée par un chinchard d'OR . Il sera attribué cette année par l'AG du mois de mars 2004, et decerné le deuxieme mardi d'avril (Bar le Pascalou - Parix XX eme - aprés la réunion des e-crivains). %%Red((heu... c'est qui ceux-là ? des contributeurs émérites et prolifiques pour Echolalie ? - c'est une réunion de personnes qui font des trucs sur le ouaibe. ça fera de l'assistance ! et puis on squatte leur lieu de réunion ))%% les listes nominées se trouvent dans ListeDeBestOf . L'attttribution des divers prix sera suivie d'un coquetel au musée de l'Ermitage.
** Prévenir les sites partenaires (ou qui pourraient le devenir) :
*** liste club de Go Paris XX (jumelé avec Echolalie)
* prévenir l'AFP (qui sait comment on fait ?)(on téléphone au 01 40 41 46 46, on demande une sténo, on dicte le communiqué - par exemple à l'attention de la Rubrique littéraire ou Chinchards écrasés - ou bien si on est moderne et que l'on possede un ordinateur, on envoie un mail à contact@afp.com. ...)
ListedeMaurice
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Allo Maurice, ça va ? ''Message lancé -- en français -- par le président des Etats-Unis (incarné par Jack Nicholson) à son homologue français dans le film de Tim Burton, Mars Attack, 1996''
* Maurice Bourdin, antipape (autrement dit un pape non reconnu par l'histoire officielle du Vatican) qui essaya de régner sous le nom de [Grégoire VIII|http://marjorie-art.voila.net/Calixte_II.htm] entre 1118 et 1121 et qui mourut en 1122 ou en 1126 ou encore en 1137...
* Maurice de Saxe (Maréchal de France) [http://www.1st-art-gallery.com/thumbnail/189993/2/Marshal-Maurice-De-Saxe-1696-1750.jpg] ''dont ce portrait fut peint par un autre Maurice, Maurice Quentin de la Tour''
* Maurice et Patapon (par Charb dans Charlie Hebdo) [http://pagesperso-orange.fr/lemomo2/Maurice_Patapon.jpg]
* Maurice James Noble, artiste américain qui participa à la création de nombreux dessins animés (1911-2011)
* Maurice Thorez (chef historique du parti communiste français. µfils du peuple et, à ce titre, __petit-fils de Joseph Staline__ réputé être le "petit-père des peuples"µ)
* Hôtel Meurice (Paris)
µµcommencé par ? - reclassée par Camµµ
ListeDeMangerEtDeBoireEnRapportAvecLaReligion
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**Cardinal (Kir vin rouge pour l'ouest parisien ; à l'est c'est un communard !)
*** Sans parler du ''rompit''... (voir ListeDeFromages)
**Posez une grande feuille d’aluminium dans le bol vapeur supérieur. Placez la moitié des rondelles de citron, des zestes et des lardons. Posez le Saint-Pierre entier, répartissez au-dessus le restant des rondelles de citron, des lardons et des zestes. Refermez la papillote de papier aluminium.
**Égouttez les champignons et placez-les dans le bol vapeur du milieu. Versez par dessus le jus d’un demi-citron vert et salez. Mettez le bol à riz avec les courgettes dans le bol vapeur inférieur. Faites cuire l’ensemble 15 min.
**Préparation : 20 mn - Cuisson : 25 mn - 4 personnes
ListeDesExpressionsPopulairesContenantLeNomDuneBestiole
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*2) dans la catégorie mettre par ordre alphabétique __DE LA BESTIOLE__
/* J'ai à ce propos cru bon de ranger les catégories par ordre alphabétique également
* Certes, pas de dérogation ? S'il y a une suite logique par exemple ? (cf la liste cousine avec des [légumes|ListeDesExpressionsPopulairesContenantLeNomDunLegume])
** ''Rappelons que l'__asticot__ n'est qu'une __mouche__ en gestation, donc un __insecte__ à part entière...µ''
* Donner sa part au __chat__
* Se tailler la part du __lion__
* Quand on parle du __loup__ on en voit la queue !
** µL'origine de l'expression est ''Pédé comme un __foc__''. Le foc étant une voile qui prend souvent un mat par derrière.µ
*** µÇa serait pas plutôt que le foc, qui est à l'avant et ne tient au mat qu'en haut, il prend le vent par derrière ? Avec en plus, peut-être, "l'attirance" de l'anglais "f u c k" ; sinon on aurait dit "pédé comme un spi".µ
* Prendre le __taureau__ par les cornes
* Parler français comme une __vache__ espagnole
* __[Serpent|ListeDeSerpents]__ à lunettes, serpent à... (''oh pardon !'')
* A se demander qui de la __poule__ ou de l'œuf est apparu en premier
** Parce que c'est __caïman__ hors sujet
* Une __baleine__ de parapluie
* Fourrée de __boa__ (''connaissez-vous cette courtisane, parée de bijoux, fourrée de __boa__... c'est la Léopolda, troulala, troulala, troulatroulalère...'') (''chanson'')
__Jeu__ : faudrait faire un texte avec tout ça (ou avec une partie au moins) !
*Vous avez le __bourdon__, envie de verser des larmes de __crocodile__. Vous finissez par vous inventer une fièvre de __cheval__ qui vous permet de filer comme un __lièvre__.
µµLancée et classée par Momo µµ
ListeDesExpressionsPopulairesContenantLeNomDunLegume
/* par PITIE ne mettez pas de liens vers de GROSSES légumes. merci
** Par dérogation les Champignons sont acceptés, ils n'appartiennent pas au règne végétal mais sont néanmoins des légumes !
***µ'' Absolument d'ailleurs il est précisé en ces termes "La complexité des cycles de reproduction sexuée ou asexuée est l'un des éléments qui ont entraîné la __création d'un règne à part pour les champignons__. La classification des espèces est d'ailleurs fondée sur ces particularités.""''µ
%%Center(Par alpha à l'exception du petit poème en bas)%%
* Se faire coller une amande par une __aubergine__
** µEuh, c'est pas plutôt avoir des touffes de cheveux collés ? [cf|http://www.paroles.net/chansons/12456.htm]%%%"Des carottes dans les cheveux%%%Qu'a jamais vu un peigne..."µ
* Les seins en __poires__ [http://www.seinsdefrance.com/paris/pari_221-20.jpg]
* Cette histoire c'est un vrai __navet__ (''en parlant d'un film, d'un livre'')
* Et finit par manger des __pissenlits__ par la racine !... [http://www.csfd.cz/posters/3/32090.jpg]
** Le compte est bon : ça fait bien __cinq fruits et légumes__ par jour... ''(nouvelle invention du politiquement correct)''
**''ce ne serait pas des __charbons__, plutôt ? Parce que des chardons ardents, j'ai beau avoir de l'imagination...''
Liste lancée par on sait pas qui (si on sait, c'est %%Red(Par __Momo__)%%) mais transformée en poème-récit par __Jeg__
ListeDePhobies
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Acarophobie : Peur des parasites de la peau. Peur des vêtements et du linge à carreaux. Peur des gens qui se tiennent à carreaux.
* Agalmatorémaphobie : (n.f.) peur que, lors de la visite d'un musée, les statues ne se mettent à parler. trouvé [là|http://jclat.typepad.com/think/mots/index.html]
* Anaérobophobie : Peur des ânes habillés en robe (Peur de Sarah Jessica Parker)
* Anatidaephobie: Peur qu'un canard soit en train de vous fixer du regard, Peur que quelque part un canard vous observe.[http://canard-wc-addict.allmyblog.com/images/canard-wc-addict/canard-wc-addict_20060525_165406.jpg]
* Angelophobie : peur des anges, déchus et autres, peur de devoir voler au paradis.
* Blorerocroqueraphobie : peur d'être dessiné par Blorer
* Dyslexophobie : peur de mal parler
* Ephébophobie - Peur des adolescents, des jeunes par ext. / peur de l'adolescence.
* Erythrophobie : Peur des érythèmes, peur de partir en vacances en Erythrée, haine du rouge.
* Iconomécanophobie : Peur des appareils photo
* Logophobie : Peur des mots (trouvé aussi : de devoir parler).
* Luposlipophobie : Peur d'être poursuivi par des loups sur un parquet de cuisine qui vient d'être ciré.
* Moderatophobie : Peur des mouvements modérato dans les partitions. Peur de modérateurs dans les forums de discussions.
* Paraskaviedekatriaphobie : Peur des vendredi 13
* Parisophobie : Peur des patrons
* Parthénophobie : Peur des jeunes filles.
* Phonophobie : Peur de parler haut. Peur de phonographes
* Urinophobie : Ou parurésie ou syndrome de la vessie timide : impossibilité ou grande difficulté pour un individu d'uriner en présence d'autres personnes.
* Wikipédiaphobie : Allergie à Wikipédia (variante de wikiphobie) µµ une allergie parfaitement justifiée.µµ
*voir aussi [ici|http://www.onestarpress.com/v2/pdf/Vidaling_sample.pdf] (intéressant) et par [là|http://cf.geocities.com/jorgette2003/phobies.htm] (page 18)
* sur Wikipédiaphobie : Pathologie bizarre et plus ou moins grave (au moins un cas répertorié parmi les echolalisteurs) qui se manifeste chez le malade par la pulsion obsessionnelle et compulsive d'effacer tout lien présent sur écholalie se dirigeant vers wikipédia. Vous disiez vous même "Les règlements de compte personnels n'ont rien à faire sur écholalie qui est un travail collectif... - Rien de personnel, juste un léger agacement face aux agissements de ceux qui appauvrissent le contenu du site au lieu de l'enrichir, ou au moins conserver le même niveau de contenu, et qui par exemple effacent sans prendre la peine de remplacer un lien (ou une image) par un autre si à tort ou à raison ils considèrent que celui-ci n'est pas le plus approprié."
µµListe concoctée par El Jj et complétée par Tiquet - détruite par un listophobe le 23/5/11 et restaurée en l'état le jour même.µµ
ListeDesExpressionsPopulairesContenantLeNomDunObjetUsuel
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(µµPar alphaµµ)%%
* Brûler la __chandelle__ par les deux bouts.
* User la __corde__ par les deux bouts (ou la __chandelle__)
* Ne jamais parler de __corde__ dans la maison d'un pendu
* Manger l'__escalier__ par la rampe
* Ouvrir le __parapluie__
* Partir en __sucette__ (''es'barre en sucette, ta mob !'')
* Partir en __vrille__
* Il convient de prévenir le __parquet__ que le __plafond__ a été atteint
Liste lancée par le professeur __Momo__ (et reclassée itou)
ListeAuthentiqueDeGaufrettesAmusantes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeSubliminaleNumeroDeux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDePhylacteres
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
# - 'l'a pas vu le Semeai qui se prépare, le joueur d'échec ! µµrhrhrh.µµ
# - (Y'a vraiment pas moyen de se séparer d'un frère siamois???)
# - Tu parles, c'est normal c'est moi le boss!
# - Je préférerai qu'on partage des jumelles !
# -''Parrolé, parrrolé parrrolé...''
# -J'habite rue de l'ermitage (en parler)
# -Je n'aurais pas du essayer de lui donner une apparence humaine
# - c'est tellement plus seyant les emmanchures raglan par rapport aux manches montées !
## - Répétons la leçon "''Il s'agit de rentrer quelque chose de plus on moins droit dans quelque chose de courbé et coudé. Il faut donc se mettre dans une position qui permette au conduit de se redresser de la meilleure façon possible, mais il ne sera jamais parfaitement droit. Il y a trois positions possibles : l'accroupissement, les jambes en l'air sur le dos et bien sûr la levrette anale, à quatre pattes, cul redressé...''" (Il/elle connaît mieux le Kamasutra que l'orthographe, celui/celle qui a écrit ça...) µabsolument, autant apprendre des choses utiles...µ
ListeDinterrogationsConcernantLeLieuDeResidence
/*par pitié... pas de grosses images concernant le lieu de résidence
%%Center(µµ__Par ordre alpha de patelin__µµ)%%
* T'habites Montholon ? µrue parisienne dans le 9ème, square au même endroitµ
* T'habites à Paris (non pourquoi, elle aurait dû ?)
* T'habites Porte des Lilas ? (75020 Paris)
* T'habites Porte Maillot ? (75016 Paris) µ(et non pas Maillol, le pôvre !)µ
*Et quand il y a des embouteillages est-ce que Moncuq est bouché parfois ?
**Il n'y aucune localité nommé Ambez, par contre existe le Bec d'Ambez à l'endroit de la rencontre de la Dordogne avec la Garonne.
µµListe réparée après sabotage... comme d'habitudeuuuuuu...µµ
ListeDesExpressionsPopulairesContenantUnNomEnRapportAveclAnatomie
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(On classera par zones (visage, tronc, membre... puis par __alpha__))%%
* Tiré par les __cheveux__
* Parler la __langue__ de bois
* Se faire mener par le bout du __nez__
* Ça rentre par une __oreille__, ça sort par l'autre...
* Les __oreilles__ de l’Elysée µµ(de Washington, du Vatican, de Moscou, bien que pour cette ville on parle plutôt de l'__œil__)µµ
* Une __tête__ d'œuf [http://www.tibooparc.com/bricolages/images/tetoeuf01.jpg]
* Sortir par les __yeux__
* Parler à __cœur__ ouvert
* Partir __ventre__ à terre
* Prendre quelque chose par dessus la __jambe__
* Partir/s'enfuir à toutes __jambes__
* Une partie de __jambes__ en l'air
* C'est à s'en taper le __cul__ par terre
***µ'Tain, y'a matière à faire une liste à part entière sur le cul !µ
! __Les organes génitaux__ [http://www.partyshop.nl/images/verkeersbord%20sex%20bomb%20inside-l.jpg]
* Chui v'nu qu'avec ma __bite__ et mon couteau µµ(et heureusement parce que sur ma __bite__, y a pas de tire-bouchon !)µµ
* Repartir la __bite__ sous le bras
* Il est reparti la __queue__ basse
!__Partout__
* Les __phalanges__ de l'ordre noir (par Bilal & Christin)
* Le __bassin__ parisien
µListe initialisée par le professeur Momo - [D'autres listes d'expressions populaires en tous genres|ListesdesListesdExpressionsPopulaires]µ
ListeDeMelonetMeleche
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*Melon et Melèche achètent une vieille maison. Melon la répare et Melèche l'habite.
*Melon et Melèche adorent les salades de crudités en vinaigrette, Melon aime tout particulièrement les carottes râpées et Melèche le poireau
*Melon et Melèche bavardaient et n'avaient qu'une seule chaise : Melon écoutait assis et Melèche __parlait debout__.
*Melon et Melèche dégustent un canard et se partagent les morceaux, Melon déguste le cou et Melèche le croupion
*Melon et Melèche déménagent : Melon achète un appartement et Melèche l'habite
*Melon et Melèche préparent des pommes de terre, Melon fait le gratin et Melèche la frite
*Melon et Melèche ont acheté des guirlandes pour décorer l'appartement, Melon en pose dans la salle de bain et Melèche un peu partout
*Melon et Melèche ont crevé à vtt, Melon prépare les rustines et Melèche le démonte pneus
*Melon et Melèche ont décidé de devenir sexologues, Melon étudie tout particulièrement les pannes sexuelles et Melèche le point G
*Melon et Melèche préparent des salades, Melon la batavia et Melèche la frisée
*Melon et Melèche préparent un braquage, Melon se procure les cagoules et Melèche le pétard
*Melon et Melèche préparent un gratin, Melon pèle l'oignon et Melèche l'aubergine
*Melon et Melèche réparent un pneu. Melon le gonfle et Melèche le trou.
*Melon et Melèche se font attaquer par un chien. Melon lui tire les oreilles et Melèche la queue.
*Melon et Melèche se partagent les gâteaux, Melon choisit le Paris-Brest et Melèche le mille-feuilles
*Melon et Melèche se partagent un sandwich : Melon prend le début et Melèche le bout.
*Melon et Melèche se sont fait piquer par une guêpe, Melon arrache la tête et Melèche le dard...
*Melon et Melèche vont chez le glacier. Comme ils ne roulent pas sur l'or, ils décident de partager. Melon achète le cornet, et Melèche les boules.
µµ euh ... l'auteur de cette liste, qui tient à conserver un ''relatif'' anonymat, a néanmoins placé son nom ''à l'intérieur '' de la liste en question. Il remercie chaleureusement celui/celle qui, dès la publication de la liste, lui en a illico apporté autant en plus !! -- Chori, on t'a reconnu. Ce n'est pas ce que tu as fait de plus BEAU dans ta vie. Mais nous vous pardonnons, car nous vous aimons. ''(JP-II)''µµ
ListeDeDebatsGrammaticauxSurLeWiki
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**µµet ce n'est pas un "commentaire", c'est une façon humoristique de participer au débat, non ?µµ
* La machine à écrire a permis de débarrasser la typographie d'un certain nombre d'archaïsmes, notamment les majuscules accentuées mais aussi les e dans l'o... Quand on fait quelque chose pendant très longtemps et que tout le monde s'en satisfait, ça s'appelle l'usage. Revenir en arrière au seul prétexte qu'on peut le faire n'a aucun sens. Les gens qui s'acharnent à vouloir accentuer les majuscules sont ceux qui traitent le français comme une langue morte. %%Red(µµ("la notion d'avenir est incompatible avec la notion de typographie puisque celle-ci est par essence non darwiniste." Murielle Globo, éditions modes et travaux - 1954)µµ)%% Leur mauvaise foi, la pauvreté des exemples qu'ils citent (le coup des congres, ça commence à bien faire...), le mépris de ceux qui pensent autrement qu'eux en dit long sur leur ouverture d'esprit
** Komenkifé le [Serge|http://www.paroles.net/chansons/14253.htm] :
**%%Green(Il existe une méthode de débat assez lamentable consistant à ne pas répondre aux arguments du contradicteur, mais à ergoter sur ce qu&#8217;il n&#8217;a jamais dit (et qu&#8217;il ne dira jamais) Ainsi : où et quand la personne citant avec juste raison un siècle d&#8217;usage aurait-elle dit qu&#8217;il ne fallait d&#8217;accent nulle part ? Il existe une autre méthode encore plus méprisable, celle consistant à insulter l&#8217;adversaire. Une langue ça évolue et ceux qui ne peuvent l&#8217;admettre se trompent de combat.µSigné le CNAM (Comité pour la Non Accentuation des Majuscules)µ)%%
**%%Blue(''La masse considérable de textes écrits à la machine à écrire depuis son invention, puis celle non moins considérable de textes tapé sur ordinateur l'ont été sans majuscules accentuées, et cela sans que cette omission pose des problèmes particuliers. On peut donc en conclure qu'ils ne servent à rien ! Donc après s'en être passé pendant un siècle quelques ringards voudraient les ressusciter. Leur unique argument consiste en quelques improbables phrases qui ne trompent personne et que de toutes façons on peut écrire éventuellement en minuscules à l'attention des ignares.'')%%
* Paradoxalement des __barbares__ : certains abus%%Red(__ants__)%% de capitales, d'autres refus%%Red(__ant__)%% de les accentuer.
** Je ne comprends pas le "paradoxalement".
* Les contempteurs des majuscules accentuées ont-ils eux même un nom contenant une majuscule accentuée ? C'est mon cas et j'exige l'accent car la prononciation est faussée si l'accent n'est pas mis. A partir du moment où c'est redevenu possible techniquement, je ne vois pas le problème.
**A PARIS ou À PARIS ? µµpendant qu'on y est ! Et qu'on m'explique ce que ça ajoute ?µµ
***Commence déjà par accorder ton texte en genre et en nombre, après tu te mouches et après tu viendras éventuellement nous donner des leçons... fin du débat
* %%Green(Apparemment il y a un seul débat. Mais est-ce vraiment un débat ?)%%
*J’aime bien ce site, il y a pourtant quelque chose, un détail certes, mais qui est particulièrement insupportable :
**Pourtant, j'ai bien l'impression qu’il y a sûrement plus de savoir, plus d’humanité, de tolérance et d’intelligence chez des gens qui font quelques fautes que chez les ayatollahs de l’orthographe qui la plupart du temps ne connaissent pas grand chose d’autre.
**J'adore Écholaliste : J'y ai trouvé des contributions à pleurer de rire - je précise : par leur contenu - d'autres d'une grande finesse ou toute autre qualité. Je NE SUIS PAS un ayatollah de l'orthographe. Il m'est cependant arrivé de corriger en douce un participe-infinitif égaré ou un pluriel de verbe, lesquels, à mes yeux, déparaient l'affaire. Une fois corrigé, c'est plus JOLI.
* J'ai un exemple tout à fait personnel de l'utilité, par absence, de l'accentuation des majuscules : mon nom de famille comporte un É. Les insupportables prospecteurs téléphoniques ne le savent pas, ce qui me permet de répondre instantanément "Ça ne m'intéresse pas..." avant même qu'ils aient pu dire de quoi il s'agit !
ListeDeSchtroumpfs
! /* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*32 Schtroumpf paresseux
*42 Schtroumpf qui a trop mangé deSalsepareille
*89 Schtroumpf partant joyeusement pour le travail
*il conviendra de réunir un concile par statuer, pour certains une correspondance a été proposé
# La salsepareille ''(n'est pas un personnage, mais on peut en boire des canettes, sous le nom de root beer)''
# Gargamelle, mère de Gargantua dont elle accoucha par l'oreille (ce qui laisse entendre que de l'autre oreille il a dû se passer de drôles de choses (Devos)
Pour s'instruire : [par là|http://www.bdoubliees.com/journalspirou/sfigures6/schtroumpfs/combien.htm] et plein de belles choses [là|http://jean.philippe.paul.free.fr] (rien à vendre) ; et pour se divertir par [ici|http://kamazutra.free.fr/smurfs/]./*quel rapport avec les schtroumpfs ? il suffit d'écouter pour s'en rendre compte ; j'ai remarqué que ça ne passait malheureusement pas sous mozilla.
ListeDesExpressionsPopulairesContenantUneLettre
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Prouver par __A__ plus __B__
* Vainqueur Par __K__ __O__
* Dial __M__ for murder ("le crime était presque parfait")
*%%Red(Les énoncés de lettres genre __Q.B.C__ ne sont pas des expressions populaires, [vous pourrez les retrouverez ici|ListeAllographique])%% µµ--Parce que vous croyez que E.T. c'est une expression populaire peut-être?µµ
Liste commencée par El Jj µ(L JJ ?)µ
ListeAntiQuatreQuatre
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Alors que la vogue des 4x4 semble enfin en voie de se calmer, nos braves couillons de __Peugeot__ et __Citroën__ en sortent chacun un, alors qu'ils étaient jusque là presque les seuls à n'avoir pas donné dans cette cristallisation stupide µµ(et criminelle)µµ de l'esprit l'Oréal ''__"Parce que je le vaux bien !"__''
µµListe ouverte par [LP|ListeDeLp] le 15 mars 2007µµ
ListedeReglesEssentielles
/* par PITIE ne mettez pas de liens vers de GROSSES règles. merci
*Faites vérifier votre liste par un organisme agréé.[http://www.mlle-c.com/blog02/liste.jpg]
* Inutile d'acheter un disque qui va passer 100 fois par an à la radio
*Laissez la femme parler, ne la coupez pas, n'intervenez pas pour citer vos propres anecdotes, elle s'en fiche, ayez l'air intéressé, ne reprenez la parole que pour la faire préciser quelque chose, elle sera ravie, aura passé une bonne soirée et sera prête pour la suite...
*Les fromages ronds comme le camembert, le munster, le brie ou la fourme d'Ambert, les carrés comme le pavé d'Est ou le maroilles, se coupent à partir du centre, en disques et en portions triangulaires [http://www.internet-fiesta.at/quiz/bilder/camenbert.jpg]
* Lorsque vous ramènerez chez vous votre nouveau chiot, il sera très certainement nerveux mais en planifiant les choses à l'avance vous pouvez faire en sorte qu'il se sente très vite comme faisant partie de la famille.
* Ne détonnez pas en adoptant un rythme décalé. Suivez le troupeau ! Arrivez à la même heure, partez avec vos collègues. Sacrifiez à cette obligation les premiers mois. Quand vous serez réellement adopté, vous pourrez plus facilement imposer vos propres habitudes
*Ne jamais s'attaquer à de la plomberie sur les arrivées d'eau lorsque l'on n'est pas sûr à 100% que l'on a les bonnes pièces en remplacement ; utiliser un appareil de mesure extrêmement précis pour s'en assurer. (Ou, éventuellement, s'assurer que l'on pourra faire pipi et prendre sa douche chez le voisin)[http://stitch.20minutes-blogs.fr/media/01/02/1099177224.jpg]
*Ne laissez pas la timidité envahir votre client, banaliser la prestation en lui parlant de la pluie et du beau temps en vous dirigeant vers le studio.
* Ne vous laissez jamais attacher par votre client, même si vous croyez bien le connaître, (on ne connaît jamais complètement les gens et personne n'est à l'abri d'un coup de folie)
*Ne vous penchez pas par la fenêtre.
*Quand je commence quelque chose, sachez que c'est toujours la paresse qui l'emporte et qu'il faut parfois attendre un petit moment avant que je ne le finisse
* Si vous ne voulez pas qu'on vous regarde par le trou de la serrure quand vous êtes aux toilettes, laissez la porte ouverte.
*Si vous utilisez les gifs animés, vérifiez bien leur utilité car d'une part une page qui bouge dans tous les sens a tendance à faire fuir les internautes, et de plus les gifs animés étant composés de plusieurs images, leur taille est souvent très grande, ce qui ralentit le chargement des pages
* Souriez ! Votre maquillage n'en sera que plus beau, vos yeux auront de l'éclat et votre fatigue disparaîtra.
*Un bon tricheur ne triche qu'une fois par partie.
ListeArmenienne
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Sergueï Parajdanov (1924 - 1990)
* Parenrian
ListeDeCeQueJaiVuEtOuJeLaiVu
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Et trois francs seize à Paris
** µµNullement : ''anis - pastis''...µµ µµmille pardonsµµ
* A Beaune, j'ai vu qu'on pouvait recevoir les journaux par la Poste
* A Paris, j'ai vu des turfistes
ListeDeMythomanesCelebres
/* par PITIE ne mettez pas de liens vers de GROS mythos. merci
** De son vrai nom Cyril Henry Hoskin, il prétendit être né au Tibet, être devenu lama, être réincarné et surtout comme il le raconte dans son ouvrage "Le troisième œil" avoir été opéré du front afin de lui ouvrir un troisième œil lui donnant "le pouvoir de voyance de l'aura". En fait il n'a jamais mis les pieds au Tibet, ne parle pas leur langue, mais ses bouquins se sont vendus comme des petits pains.
**Romancier américain et mystificateur. Il est notamment l'auteur de "The Amityville Horror: A True Story" (1977) qui sera adapté au cinéma en 1979 par Stuart Rosenberg (le film tout comme le livre clamera haut et fort s'être inspiré de fait réels et cela participera à son succès commercial). En fait, si Amityville fut effectivement le théâtre d'un sextuple meurtre en 1974, la suite est une mystification montée de concert par le romancier Jay Anson et les époux Lintz qui achetèrent la maison.
** Couturier français (c'est lui qui habilla Jane Fonda dans le Barbarella de Vadim en 1968). Se rendit célèbre en prédisant la chute de la station spatiale russe "Mir" sur la Terre le 28 juillet 1999, puis le 11 août 1999. (le jour de l'éclipse de soleil visible à Paris) Raconte aussi qu'il vient d'une planète autour de l'étoile Véga et autres élucubrations...
** Elle apparaît en 1817, habillée de façon exotique et parlant une langue inconnue. Sur le point d'être arrêtée pour vagabondage, elle est recueillie par une riche propriétaire qui sera vite convaincue que la jeune femme est une princesse indonésienne, enlevée par des pirates et qui a réussi à s'échapper… un journaliste s'empare de l'affaire, et la "princesse" devient la coqueluche de la haute société. Confondue par un redresseur de tort, elle part aux Etats-Unis, s'invente une aventure avec Napoléon à Sainte-Hélène. Elle finira sa vie en Angleterre comme vendeuse de ventouses à l'hôpital de Bristol. L'histoire fut portée au cinéma par Michael Austin en 1994.
**Pendant 18 ans il fit croire à tout le monde qu'il travaillait à l'OMS. En réalité il n'avait aucun diplôme de médecine et vivait de la vente de faux médicaments. Quand sa femme apprit la vérité en 1993, il l'assassina (rouleau à pâtisserie) ainsi que ses enfants (22 long rifle), ses parents et son chien. Il mit le feu à sa maison (mais les éboueurs passaient juste à ce moment là) et tenta de se suicider (mais les barbituriques étaient périmés)... Condamné en 1996 à à la réclusion criminelle à perpétuité. Un roman d'Emmanuel Carrère a été écrit d'après cette histoire, puis un film de Nicole Garcia (L'Adversaire, 2002 avec Daniel Auteuil)
*''Alexandra Paressant'' (née en 1979)
**Mannequin mythomane. S'invente en 2006 des aventures intimes avec le basketteur Tony Parker, puis avec les footballeurs Ronaldinho et Thierry Henry. Démasquée, elle a réussi néanmoins à se faire un nom et à publier un livre : "Sexe, Scandales et Internet" en 2009 dans lequel elle avoua avoir tout inventé.[http://nikosolo.voila.net/Impostures/alexandra_paressant.jpg]
** réalisera une interview de Fidel Castro qui passera sur TF1 le 16/12/1991. Le problème c'est que les deux hommes ne se sont jamais rencontré ni même téléphoné, toute l'interview est un trucage intégral, le scandale fut démonté par plusieurs journalistes. Pierre Carles notamment, fit un sujet là-dessus, et fut viré de la télé. N'importe qui à la place de PPDA serait mort de honte, pas lui.
**Etablit à la demande de l'empereur Constantin les fondamentaux du Christianisme. Il est à ce titre l'auteur (et l'unique source) de la liste des 12 premiers [papes|ListeDePapes] considérée par la majorité des écrivains comme apocryphe. Citation : ''Nous mentionnerons généralement uniquement les événements qui peuvent être utiles d'abord à nous-mêmes, ensuite à la postérité.''
**On ne connait pas sa véritable identité ! Publie en 1704 un livre dans lequel il se prétend le premier formosan à visiter l'Europe "Description historique et géographique de l'île de Formose " Ce livre décrivait des coutumes locales totalement imaginaire, et même un alphabet, un lexique et une grammaire. Ce livre réussit à faire autorité durant tout le 18ème siècle, il fût traduit en français et en allemand, et fut inviter à donner cours et conférences dans des universités prestigieuses et des sociétés savantes. Il finit par avouer la supercherie à partir de 1706.
** En 1997 elle fait paraître aux Etats-Unis, puis en France un récit se prétendant autobiographique et s'intitulant "Survivre avec les loups". Il raconte l'histoire d'une petite fille juive qui parcourt 3000 km à la rechercher de ses parents et qui trouve refuge auprès d'une horde de loups. Immense succès de librairie (200 000 exemplaires vendus en France, traduit en 18 langues, adapté au cinéma en 2007 par Vera Belmont) Le film provoque un certain scepticisme (confusion de dates, invraisemblances) et après une violente polémique l'auteur avoue en 2008 que tout cela n'était que supercherie.
*''[José Luis Jordan Peña|http://pagesperso-orange.fr/oncle.dom/paranormal/ovni/cas/ummo/pena/pena.htm]'' (né en 1931) :
**En 1966 il écrivit plus de 200 lettres dactylographiées (avec une machine Hispano Olivetti modèle studio 46) illustrées de croquis aux crayons de couleurs décrivant dans les détails les habitants d'une planète nommé [Ummo|ListeDeChosesAdireSurUmmoEtSurLesUmmites]. Malgré les absurdités et les incohérences contenues dans ces lettres, les destinataires y ont cru, et même un chargé de recherche au CNRS. Il organisa aussi trois reportages truqués de rencontres avec des OVNIS. En 1993, alors qu'une secte se réclamant de la mouvance pro-ummo se livrait à des choses inavouables, Peña avoua la manipulation. Ça ne fait rien certains continuent d'y croire quand même, à écrire des livres et à gagner du fric. (voir Jean-Pierre Petit - Enquête sur des extra-terrestres qui sont déjà parmi nous — Le mystère des Ummites, 1991)
**Dans le "Le Testament de Dieu" (1978) invente une déposition d'Himmler au procès de Nuremberg !(''Himmler n'a jamais été jugé, il s'est suicidé aussitôt après son arrestation'') et qui dans "De la guerre en philosophie" (2010) nous parle le plus sérieusement du monde de Jean-Baptiste Botul, philosophe qui n'existe pas !
* ''David Martinon'' (guignol et porte parole de l'Elysée, né en 1971)
**En 1090, les croisés cherchent mais ne trouvent pas le village de Nazareth où aurait vécu Jésus. Nazareth n'existe pas ! Nazareth sera fondé au XIIIe siècle en rebaptisant le village arabe En-Naçira... Les croisés construisent aussi l'église Saint Gabriel, les thermes et le puits où l'ange Gabriel serait apparu à Marie pour lui annoncer qu'elle allait enfanter Jésus.
**"Pendant le concile j'ai prié Dieu afin que je ne sois pas élu pape". Alors que dès la mort de son prédécesseur il a tout mis en œuvre (de façon très efficace) pour se présenter comme son meilleur successeur possible, un peu à la manière soviétique où l'ordonnateur des pompes funèbres du défunt secrétaire général du parti devenait à son tout secrétaire général du parti. [http://www.tldm.org/News6/Ratzinger.jpg]
** occultiste, faussaire et antisémite... inventa __[l'ordre de Nautonniers des Prieuré de Sion|ListeDesNautonniersDuPrieuredeSion]__ en... 1956 date de son enregistrement à Annemase comme association à but non lucratif... son délire a été repris dans le best seller de Dan Brown "Da Vinci Code". A ne pas confondre toutefois avec __Les Protocoles des Sages de Sion__ écrit (on devrait dire plagié) à la fin du XIXe siècle par Mathieu Golovinski (1865-1920), ouvrage antisémite qui relève non pas de la mythomanie mais de la propagande. L'imposture fut démontée par le Times en 1921.
** ancien directeur de recherche au CNRS, il met au point sur le papier la Propulsion MHD (Magneto Hydro Dynamique) dont il dit avoir eu la révélation en lisant les lettres des habitants de la planète Ummo. Il racontera tout ça dans "Enquête sur des extra-terrestres qui sont déjà parmi nous"
*Je me suis permis de déplacer le paragraphe consacré aux écrivains dans la liste suivante : ListeDePerlesDansLaLitterature, les bêtises qu'ils ont pu écrire relevant bien évidemment plus de la gaffe que du mensonge !
ListeDesDouzesApotres
/* par PITIE ne mettez pas de liens vers le ciel. merci
# Judas Iscariote /*remplacé par __Mathias__ (source ?)
# Judas Iscariote [http://www.paroisse-coutances.com/images/anciennes/20baiserjudasGL.JPG]
**affublé parfois du titre d'apôtre des Nations ou d'apôtre des gentils !!!
***µ''Oh, mais c'est qu'il était gentil l'apôtre !''µ µµ-- Comme disait l'autre, c'est grâce à lui que les chrétiens ne sont pas circoncis; mais c'est plutôt parce qu'il n'a pas exigé la circoncision qu'ils se sont convertisµµ
**Mais c'est parce que Paul ne faisait pas partie des 12: sa conversion (sur le chemin de Damas) vient après les aventures de Jésus au pays des humains...
*__Par contre on trouve aussi parfois__ :
*Il existe environ 70 [évangiles|ListedEvangiles] , sur ces 70, 4 ont été "retenus" par l'Eglise __au IVe siècle__ dans le Nouveau Testament, il s'agit donc d'un tri arbitraire...
*** Saint-Jean ? Certes on le disait jeune, mais efféminé à ce point ? Et à cette place d'honneur en symétrie parfaite y compris vestimentaire avec Jésus ? Une femme plutôt Marie-Madeleine alors ? Qui aurait piqué la place de qui ? Sacré Léonardo !
ListeDeHerosDessinesDeMonEnfance
!!! /* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Histoire sans parole
* Sam Bot µ(par le frère de Buzzelli !)µ
µµ Je voulais parler de mon enfance __à moi__ c'est à dire il y a __très très longtemps__ , et il y a donc des choses très/trop récentes, mais bon, plus on est de fous...-- sans compter qu'on n'est __jamais trop BD__ !µµ
ListeDesMangeursDeCigognes
/* par PITIE ne mettez pas de liens vers de GROSSES cigognes. merci
*Préparez la farce : pelez et hachez finement les oignons et les échalotes.
*Versez dans le plat 25 cl de bouillon préparé en diluant la tablette'.
µµ''recette moyenâgeuse de Johan de Brandicourt réactualisée par Michel D plusieurs siècles après...''µµ
*Préparation : 40 minutes
*Préparation : 30 minutes
*Ce plat peut se préparer la veille et se faire réchauffer au moment de servir
* Préparer la sauce : mélanger dans un bol 3/4 de mayonnaise avec 1/4 de crème fraîche, ajouter un peu de poivre moulu
*MULHOUSE (AFP) - Du foie gras 100% cigogne sur les tables alsaciennes lors du prochain réveillon: l'information publiée sur une pleine page par le quotidien l'Alsace a floué plus d'un lecteur vendredi.
*"Il faut bien dire que quand on voyage en Alsace, on voit plus de cigognes que d'oies", écrit le journal tout en prétendant qu'une société polonaise se préparerait à commercialiser le foie gras de cigogne en Alsace à l'occasion des prochaines fêtes de Noël et qu'elle prévoirait même d'implanter une unité de production en Alsace. "Le problème technique auquel vont se trouver confrontés les éleveurs est la longueur du bec et du cou des cigognes pour le gavage", relève toutefois la légende d'une photo de cigogne tenue par le cou par un soi-disant "éleveur". Pour accréditer le poisson d'avril, le journal n'hésite pas à proposer une recette de foie de cigogne poêlé avec sa poitrine fumée sur choucroute et tarte fine aux lardons, présentée par le chef Patrick Fulgraff, patron du "Fer rouge" à Colmar, partisan de l'idée qu'il faut "battre le fer tant qu'il est chaud". "Le gastronome, relève pour sa part le chef, remarquera le fondant du foie, son grain très fin, son goût de noisette". Un petit encadré sur "la grogne des anti-gavage" note enfin que la commercialisation du foie gras de cigogne ne manquera pas de relancer la polémique sur le gavage des animaux auprès des défenseurs des oiseaux qui ne seraient apparemment pas prêts à avaler "cette couleuvre supplémentaire".
ListeDeFees
/* par PITIE ne mettez pas de liens vers de GROSSES fées. merci
%%Center(µµReclassée par ordre alpha par la Fée Tovillage !µµ)%%
%%Center(''Chaque fois qu'un enfant dit: «je ne crois pas aux fées», il y a quelque part une petite fée qui meurt. Sir James Matthew Barrie (Peter Pan - 1904)'')%%
* La Befana (folklore italien) souriante et offrant bonbons et cadeaux, malgré son apparence de sorcière.
* La Lavandière de nuit : Il faut faire très attention de ne pas rencontrer cette femme, qui est une fée de la catégorie des dames blanches. Elle demande aux personnes qu'elle rencontre la nuit, de l'aider à tordre le linge qu'elle est en train de laver au bord de l'étang ou d'une mare, et si la personne accepte celle-ci mourra étranglée par la lavandière (pas de bol)[http://katy30.unblog.fr/files/2007/09/fee2nn1.gif]
* Mélusine : C'est une des plus belles fées, une dame d'une beauté éblouissante. Le malheur c'est qu'elle se transformait tous les samedis en sirène en pénitence de ses fautes et lorsque son mari (Raymondin) le sut, le sort jeté sur elle fît qu'elle ne reprit jamais son apparence humaine (pas de bol) %%%
**''C'était surtout une vouivre, créature mi-femme, mi-serpent. C'était la minute mythologique, par mam'zelle marine. Tout de suite une page de pub''.[http://sachatchenko.voila.net/Mutantes/Melusine_et_Raymondin.jpg]
* Urgèle, citée notamment par Voltaire et Balzac
* Gaudriole, vilaine fée qui a enlevé un prince et éparpillé les différentes parties de son corps. Mais la princesse Athénie va le secourir par une belle métaphore érotique.
* La Bonne Fée, (''Sailor et Lula'', de David Lynch, 1990) jouée par Sheryl Lee
* La Fée Ténébreuse, (dans ''Le sultan Misapouf et la princesse Grisemine'', de Claude-Henri Fuzée de Voisenon, XVIIIème siècle) qui transforme le jeune sultan en baignoire, pour lui coller 'son gros derrière noir et huileux' sur les yeux incrustés dans la paroi.
* La Fée Vicieuse, dans "Tendrebrun et Constance" (Mme de Lintot). Perturbée par sa libido, la charmante porte une corne sur le front.
** µµparce que le fée illicite, ça ne le fait pas...µµ
* La Fée Riée, en voie de disparition
* Les Fées d'surprise, apparaissent toujours à brûle-pourpoint
* Les Fées Mer, apparaissent sur les plages le temps d'une marée
** ''Le mois de Mai, parce qu'en Mai, fée ce qu'il te plait''
* La Fée Carabosse (parce que c'est une [sorcière|ListeDeSorcieres] !)
* La Fée Cléafette : aussi connue sous le pseudo "orangina rouge" dans les soirées mondaines. µ(toute précision serait bienvenue parce que Google ne nous dit quasiment rien sur ce coup là !)µ
ListeDeLaCravate
/* par PITIE ne mettez pas de liens vers de trop nombreuses images. merci
* Celle qui toujours le matin m'attrapait par la cravate et m'attirait dans le lit (elle faisait quoi à ta cravate ?).
* Cinépimastie (ou Coït intermammaire ou Mammagymnophilie ou encore Mazophallation) : masturbation entre les seins (on parle aussi de "branlette espagnole", de "cravate de notaire" ou d'Entrenichon) - µ''certains écrivent ce mot avec un ou deux y, il n'y a aucune raison... et de nombreux dictionnaires du sexe l'orthographient à tort cinépysmathie)''µ
* Rue de Palestro : Paris II : Je distribuais des prospectus dans cette rue avec un collègue quand notre regard fut attiré par une plaque noire sur laquelle était indiquée en lettres d'or et en toute simplicité : "__Georges 1er, Roi__" ! Bizarre ! Nous pensions d'abord à une sorte de marabout vu la vétusté de l'immeuble et par curiosité nous entrâmes, il semblait être ici le seul occupant nonobstant un entrepôt et un bureau occupé par un exportateur d'arachide. Par défi, nous sonnâmes à la porte du roi "Bonjour, nous faisons un reportage sur les souverains domiciliés à Paris…. " Sans nous laisser finir, le dénommé Georges 1er, un solide gaillard de type africain, vêtu d'un élégant complet beige, d'une chemise en soie et d'une cravate fantaisie, nous fit entrer dans un salon qui aurait eu besoin d'un petit peu de ménage et où une très belle femme blonde en tenue de soubrette nous servit des rafraîchissements. Un peu gêné nous nous demandions comment nous sortir du guêpier dans lequel nous nous étions fourrés ! "Vous êtes le roi de quoi ? "Osais-je demander ! Sa majesté attrapa alors un fou rire ! "Le roi de quoi, mais le roi de la cacahuète, bien sûr !"
* Un vieux monsieur, tout maigre, la cravate par-dessus l'épaule, qui criait après une voiture ayant brûlé
*µµMessire Belzébuth tire par la cravateµµ
ListeDeNouveauxSignesAstrologiques
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
*__La Gamelle__ (22 Marsorier- 21 Calusier) - Les natifs de la gamelle font preuve d'un équilibre fragile, et traînent tout au long de leur vie leurs erreurs de jeunesse qui ont parfois du mal à ne pas répéter. Ils fuient les événements festifs et conviviaux, préférant les plaisirs solitaires.
*__Le fer à Repasser__ (23 Osiambre – 22 Hariet) – Les natifs du fer à repasser se distinguent par une grande capacité à glisser sur les problèmes et par un caractère bouillant.
*__Le tire bouchon__ (23 Hariet – 22 Jossombre) – Les natifs du tire bouchon se distinguent par un esprit tordu et par leur capacité à succomber aux plaisirs bassement matériels.
*__L’égoïne__ (23 Jossombre – 22 Fangluef) – les natifs de l’égoïne se distinguent une capacité de créer ou d’étonner au moment où on s’y attend le moins (par exemple : se mettre à bricoler alors qu’on vient juste de leur demander de pendre les draps)
*__Le cerceau__ (23 Fangluef – 22 Cariars) – Les natifs du cerceau se distinguent par leur esprit ludique et leur capacité de pouvoir arrondir les angles
*__Le grille-pain__ (23 Gingembre - 22 Glutier) - Les natifs du grille pain se distinguent par la recherche de relations chaleureuses qu'ils rejettent assez vite. Dans certains cas, ils se bloquent et les conséquences peuvent être dramatiques
* __Le trusquin__ (48 vendémiaire - 12 morilles) - Les natifs du trusquin relèguent généralement des arpions, et certains sont même podagres. La plupart manifestent une fascination déraisonnable pour la programmation structurée, alors qu'ils répugnent le plus souvent à s'engager dans le combat politique - fût-il légitime.
* __Le chinchard__ (23 Cariars – 22 Tovimbre) – Les natifs du chinchard se distinguent par leur esprit rationnels et ouvert. Ayant les défauts de leur qualités ils en abusent parfois et peuvent alors se livrer à de périlleux exercices d’enculage de mouche
*__Le marteau__ (du 1° à 29 pédale) - Bien que foncièrement bons et gentils les natifs du marteau sont inaccessibles à la notion de négociation (la chose leur paraît absurde), ce qui fait d'eux de parfaits asociaux.
*__Le phacochère__ (12 Pluviose - 18 Brumaire) - Le natifs du phacochère sont indolents et se font porter par l'existence avec philosophie tout en affichant un grand hédonisme. Pragmatiques ils n'échangent leurs opinions que quand ils espèrent un résultat
*__Le typographe__ (29 février - 1er avril) - Les natifs du typographe se caractérisent par une volonté de défendre l'ordre établi et la tradition, sans se poser un seul instant les questions de savoir si ces traditions en sont vraiment et pourquoi elles existent. [Toute tentative d'évolution est ressentie|http://users.skynet.be/typographie/faq/Capac.html] comme une agression personnelle. Le typographe n'a pas bon caractère et il difficile de composer avec.
* __La cagole revancharde__ (18 brumaire - der rièralaire) - Les cagoles revanchardes gagnent à être connues. Portées sur le bricolage et les activités manuelles elles n'en sont pas moins de grandes mystiques capables de s'investir sans retenue dans l'onomastique vectorielle ou la prétérition rétrograde. Aucune chance de les apparier avec un glandulaire.
* __Le Paon__ (10 cakcarante - 15 skokoption) - Les natif du paon s'accommodent fort bien du balai dans le cul dont ils ont été dotés à leur naissance. Leur cerveau est autant bardé de certitude que leur porte carte de cartes bancaires. Sont parfois amusants quand ils ont bu un petit coup de trop.
**''Parfum : n°5 de chez Chanel''
**Le signe de la caméra, de l'ordinateur, du clonage, de l'ADN, des paraboles (ou radiotélescopes, antennes paraboliques), du sex shop, de la psychanalyse, de la seringue hypodermique, du vibromasseur, de l'astronaute."
µµ23/2/02 Par professeur Momoµµ
ListedEmissionsdeRadioDefuntes
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
! France inter (ex Paris Inter)
* Florilège de la musique de genre de Pierre Marcel Honder : Onézime Grosbois par exemple ..
** remplacé par Le Fou du Roi (Stéphane Bern), lui-même remplacé par les Affranchis (Isabelle Giordano)
* Les maîtres du mystère (chantés par Ph Chatel)
* les Décraqués µµ j'ai été étonnée que cette émission initiée par Perec manquât à la liste. Heureusement les Papous persévèrent ! µµ
* Qu'est-ce qu'on peut faire d'autre un dimanche matin avec un temps pareil ? Tiens ! mets donc la radio, là au moins, y'a de la musique (encore de ce génie de Françis Blanche).
* Coïncidences : F Blanche repèrant tous les plagiats musicaux des compositeurs de chansonnettes appointés par la Sacem... et son entreprise de "Démammatisation de la France", en utilisant toutes les versions possibles de "La Mamma", cette scie d'Aznavour...
* La chronique de Georges Atschuller et Georges Leroy (du temps où Etienne Mougeotte, patron de l'info, se faisait censurer par Chirac pour "persifflage " (sic) ; les temps changent...)
* Les dernières nouvelles de demain (Par l'insupportable Geneviève Tabouis : ''Attendez-vous à savoir que dans les chancelleries...'' — C'était sur Radio-Luxembourg, son mari Robert Tabouis ayant été administrateur de la station. Il me semble que, le dimanche midi, elle succédait au "Tribunal' de Pierre Destailles et Yves Deniaud)
* L'homme de vœux (sponsorisé par l’apéro "Barre toi au sol")
* Les découvertes de Nanette Vitamine (sponsorisé par Banania: "Petit déjeuner délicieux, Ba-na-nia, goûter, entremets savoureux, Ba-na-nia'))
* le Tribunal : avec Pierre Destailles : Président, et Yves Deniau : le lampiste Le Guignon, toujours condamné mais réconforté par "La Boldoflorine, la Boldoflorine, la bonne tisa-ne pour le foie.." et au piano ? Luis Matchaco!
* Ça va bouillir (Sponsorisé par Sunil, avec Zappy Max ! Qui se rappelle de Kurt Von Schtrafenberg alias le Tonneau et de son acolyte, le professeur Schildkraut?)[http://maxradioplus.free.fr/Page_22/IMAG0021.JPG]
* Faites nous marcher, offert par Baranne. le dimanche matin
* 100 Francs par seconde : une fortune même en anciens francs (et beaucoup de tartes à la crème et de machines infernales...) sponsor : Dubonnet ("Buvez-donc quand ça vous plaît, un bon Dubo-Dubonnet : c'est le quinquina parfait, Dubo-Dubon-Dubonnet")
* Seul contre tous : Pierre Desgraupes ,un candidat , une ville ...pourquoi Picon ? parce que c'est bon!
* Sérénade (sponsorisé par les parfums Bourjois avec un j comme Joie)
* "???? " émission du midi avec Jacques Martin et Jena Yanne qui mettaient en musique (grégorien..) les pubs , accompagnés par Popof au piano ou à l'harmonium
* "Quand j'entends le mot culture, je sors mon transistor" par Jean Yanne, Daniel Prévost, Sophie Garel et Maurice Vamby qui ridiculisent l'émission précédente et d'autres de Luxembourg (Le Match de la vie, Ménie Grégoire), sans parler de Bossuet, Ambroise Paré, Robert Houdin, etc.(Jean Yanne viré en mars 1968!)
*et les démêlés quotidiens de Philibert et de son père avec les voisins, tous les personnages étant interprétés par Jacques Bodoin ("Attention, Philibert, je vais me fâcher! — Peuh! Tu parles!")
*"L'Heure musicale", présentée le dimanche soir par Pierre Hiégel, sponsorisée par Kléber-Colombes avec comme indicatif les danses polovtsiennes du "Prince Igor" de Borodine.
* Le jeu des mille francs Euh... Il existe toujours, sauf que c'est [le jeux des mille euros|http://www.radiofrance.fr/chaines/france-inter01/emissions/jeu1000euros/]µ - Tu te souviens, Maman, de not' temps ça s'appelait 100 francs par seconde ? -
* les pubs :"Merci Monsieur Ségalot , çà c'est du meuble" , "Bien l'bon jour M'sieur Levitan, vous avez des meubles, vous avez des meubles. Bien l'bon jour M'sieur Levitan, vous avez des meubles qui durent longtemps" , "André Brun le couturier de la Fourrure, avenue de Clichy Paris" (sur l'air du "Roi d'Ys", de Lalo, et c'était plutôt "29 rue de Clichy, Paris"), "Avec Volkswagen pas de problème",...
ListePressBook
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* [l'Art des listes|http://podcast.rsr.ch/media/on-en-parle/20080312-psycho-l-art-des-listes.mp3] télévision suisse romande mars 2008
* [blog2|http://www.u-blog.net/unsiteparjour/note/9161]
* [Ornella|http://v1.grifil.com/cgi-bin/reacteur.pl?partenaire=26&mot1=ornella%20mutti]
* [Recherche|http://www.univ-paris3.fr/recherche/sites/edlfc/fre2332/liens.html]
* [Turbines|http://www.reacteur.com/cgi-bin/reacteur.pl?mot1=turbin+travail&partenaire=]
* Paris-[Dakar|http://web.archive.org/web/20070206162503/]
ListeDeChose
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
%%Center(Tout dire du visible est un aveu d'invisible.%%%Tout dire de la chose imperceptiblement la change.%%%Il n'est dire, à son départ, qu'en la sollicitant.%%%Dans son impulsion même, dans le sourd élan qui l'ébranle, il l'éprouve comme ce qui, d'une certaine manière, n'a pas encore dit son nom.%%%__Roger Munier__)%%
** Et la version [sonore|http://www.poesie.net/motchose.ram] µµ''(Zut, ça ne marche plus)''µµ µµ(Il en existe une splendide version par le groupe Chanson plus bifluorée...)µµ
ListedesFilmsQuOnPossedeMaisQuOnAhonteDePasserAuxAmis
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
****San-Antonio de Frédéric Auburtin, 2004 avec Depardieu (Béru) et Lanvin (San Antonio)
* La [traversée de Paris|http://youtube.com/watch?v=Zw3sVA6-Prs] (''Jambier...'')
ListeDeChosesQueJaimeraisFaireouRefaire
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* accepter les gens comme ils sont (et avoir envie qu'ils fassent pareil !)
* arrêter de compter les années qui me séparent de la retraite
** ne plus avoir à compter les années qui me séparent de la retraite
* avoir parfois le courage de dire ce que je pense
* couper la sonnerie du réveil parce qu'on ne se lève pas le lendemain matin
* dénicher ''Notes'', de Depardon
* la face nord de la butte Montmartre (par la rue Caulaincourt) en solo et en hivernale[http://www.afiphoto.com/images/Montmatre%201.jpg]
* offrir des cadeaux juste parce que j'en ai envie
* parler le langage des signes
* partir à l'étranger sur un véritable coup de tête. Se retrouver à la gare, sans rien d'autre que son passeport, et acheter un billet en dernière minute pour Rome ou Toulouse. Avec un inconnu embarqué sur le chemin si possible.
* régler mes problèmes par rapport au temps (et au retard)
* repartir faire un tour en Scandinavie
* tomber -par hasard- sur ''Empty Places'', de Laurie Anderson
ListedeChansonsetdInterpretesQueJaimeEcouterEnVoitureDepuisPlusouMoinsLongtemps
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* __[La complainte de l'heure de pointe|http://www.joedassin.info/fr/chanson-paroles86.html]__ Joe Dassin
* __Maxie, Madge et parfois Dicky Wagner__ D. Mc Neil
* __Paradis blanc__ Michel Berger
* __Puisque tu pars (live)__ J.J Goldman
* __This side of paradise__ R. Ocasek
ListeDePropositionsDeContraintesEpistolaires
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* écrire une lettre au Diable pour lui proposer un marché honnête (votre âme à l'échéance contre une partie de bilboquet avec Ornella Muti)
* écrire une lettre au président de la ''Fédération des bougnats de Paris'' vantant les mérites de l'eau ferrugineuse
* écrire une lettre avec ses pieds pour voir si elle/il vous répondra avec une partie non moins inattendue de son anatomie
* écrire une lettre d'amour à son percepteur en paraphrasant les idées de Warren Buffet.
* écrire une lettre dans une 4X4 lancée à vive allure, sur un beau parchemin et à l'aide d'une plume d'oie, sans faire de taches
** Celle-ci alors ? ''Je suis à vous si vous le désirez'' (µ2+4+1+4+2+4+2+7µ)** µmhh oui, mais celle-là, elle ne commence pas par __a__...µ
* écrire une lettre de démission de l'UMP par permutation des caractères employés dans l'''Appel du 18 juin''
* écrie une lettre de dénonciation par laquelle vous dénoncerez tous les philatélistes de votre entourage.
* écrire une lettre de la part de ''Melon'' , destinée à ''Melèche''
* écrire une lettre de remerciement à ses parents pour tout.
* écrire une lettre en langage SMS puis l'envoyer par pigeon-voyageur
* écrire une lettre en ne rédigeant qu’une ligne par jour
* écrire une lettre enflammée aux Pompiers de Paris (''ou d'ailleurs'')[http://lali.toutsimplement.be/wp-content/arinamakaryan.jpg]
* écrire une lettre non vulgaire -- µtrop dur, patron ! Aidez-moi, par faveur.µ
* écrire une lettre où l’on parle de soi-même à la troisième personne du singulier
* écrire une lettre où l’on parle de soi-même à la troisième personne du pluriel
* écrire une lettre par jour mais ne les envoyer que l’année suivante, à la date anniversaire
* écrire une lettre parlant uniquement de choses et de gens que le destinataire ne connaît pas
* écrire une lettre sur du parchemin ''encore vivant''
* graver une lettre pariétale sur la face nord des Grandes Jorasses (voie du Linceul) et trouver un moyen de la faire parvenir à son destinataire
* écrire une lettre au directeur de la télévision pour le féliciter du conformisme et de la débilité des programmes diffusés par ce média.
ListeDeMenusPlaisirsSensorielsPersonnels
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
**Etr particulièrement le nombril des femmes d'agents de police...
# Les statues du Parc Vigeland [http://2.bp.blogspot.com/_pTOnNvlvkJo/TEXUoSXx0rI/AAAAAAAABF0/SAafgeSbirA/s1600/norway+67+vigeland+park.JPG]
# Une participation à une des listes d'Echolalie qu'on avait faite et oubliée
# La ficelle du string qui disparait entre ses fesses
# Se faire tripoter les fesses par une masseuse thaïlandaise
# Chanter à tue-tête "''veux-tu monter dans mon bateau''" en partant se balader en voiture avec une bande de gniards
# Le mélange des parfums de l'essence et de l'herbe pendant la tonte de l'aérodrome
# Le jus d'orange que ma mère presse parfois le matin
# µSortir du boulot et se dire, à cause d'une certaine qualité de la lumière, d'un parfum de sève en marche - un peu comme la pluie d'été - que, oui, le printemps est en train d'arriver.µ
# Marcher sous la pluie sans parapluie
# Marcher sur l'herbe encore mouillée par la rosée du matin
# Prendre son temps et ses aises pour déféquer, (tout en lisant µpar exempleµ la biographie de John Forbes Nash, µmais répétons le, ce n'est qu'un exemple, d'ailleurs on est pas obligé de lireµ)
ListeDeClement
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
[http://www.uniquecarsandparts.com.au/images/history/founding_fathers/clement_adolphe.jpg]
ListeLitterale
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* Surpris par la découverte d'une partition de "la flûte enchantée" parmi les lapereaux nouveau-nés, le cuniculiculteur se demanda : "est-ce à __portée de lapine__ ?"
* Trés vexés d'avoir été vaincus par les mousquetaires du Roy, les hallebardiers de la Reine se suicidèrent en groupe, se jetant du haut de la tour de Nesles. "__Il pleut des hallebardes__ ", observa le Cardinal dissimulé dans son échauguette.
* L'ayant reconnue __par derrière__, ces couards de barbaresques abandonnèrent Catherine Ségurane, et le siège de Nice également.
* Raymond avait laissé le pot-au-feu mijoter sur le gaz avant de partir au bar. A son retour, la maison avait brûlé ; "__Les carottes sont cuites__", observa-t-il sobrement.
* Ayant raté son fils, Wilhelm Tell fut rapidement introuvable, il était parti se planquer __en Suisse__.
* Antoinette de [Gabolde|http://www.echolalie.com/feuille.htm] d'Audan rapporte dans sa biographie cette anecdote savoureuse : Alors qu'elle participait aux côtés d'Albert Einstein à un colloque scientifique, ce dernier, lancé dans une discussion animée avec le grand Schtroumpf, finit par lui déclarer : ''Je suis désolé, cher collègue, mais vous ne m'__arrivez pas à la cheville__ !''
* A sa manière le vieux Luis, bourreau de son état, n'était pas un tendre. Malgré le garrot, Alonzo parvenait encore, quoique de plus en plus faiblement, à médire du général Franco; Luis dut __serrer la vis__.
* Après mûre réflexion, Jack posa sa pierre et, __tout de go__ , il réalisa triomphalement qu'il avait perdu la partie, comme à son habitude.
* Lorsqu'après quelques mois d'abstinence due à un récent séjour à Fresnes, le Roger s'est vu administrer une turlute particulièrement soignée par la grosse Lulu, il lui en a mis __plein les yeux__ !
* Charlie me fit visiter le potager, le dernier carré était attaqué par les bestioles grave, c'était __la fin des haricots__.
* "Arrêtez de me __mater__ !" s'écria Antoinette de Gabolde d'Audan. Le regard libidineux de son adversaire l'empêchait de se concentrer sur la partie d'échecs en cours.
* Assommé par l'importance de sa découverte, Newton __tomba dans les pommes__.
* Ayant dressé la liste de ceux qu'il ne comptait pas inviter, il la laissa malencontreusement choir dans le seau où il préparait le boudin; pour le coup, ils se retrouvèrent vraiment en __liste rouge__ !
* Tournant dans la ferme un ''remake'' de Farrebique avec des participants locaux, l'actrice porno s'était fait ce jour-là une magnifique __queue de cheval__.
* Au bal costumé, Léon déguisé en chat était parvenu à coincer Thérèse, également en félidé, et il lui __faisait minette__.
* En proie à un orgasme particulièrement intense elle __prit son pied__ et le mordit violemment.
* Georges Brougnard nous narre dans son autobiographie ce souvenir d’écolier : un jour de grand froid, il avait dû se réchauffer d’un chocolat chaud dans un café se trouvant sur son chemin. Puis par distraction, il partit sans payer. Le patron du lieu ne s’en aperçut pas de suite, mais constata qu’à la place qu’il occupait restait une petite pochette. Il l’ouvrit et en découvrit l’intérieur : Georges Brougnard avait __laissé une ardoise__ !
* Je ne pensais vraiment pas que le fait de lui dire que j’avais une autre maîtresse mettrait Antoinette dans un tel état ! Furieuse, elle s’empara de tous les objets se trouvant à sa portée dans l’étroite salle de bain et me les balança à bout portant en m’invectivant. __J’ai reçu un de ces savons__ !
* C'était pourtant Paulette qui avait convié Roger à pique-niquer sur la Marne, mais quand elle a vu son engin, elle a dit : ''non, merci !'', et il est reparti __la bite sous le bras__.
* Je pouvais voir de ma jumelle l'immeuble en face, une sorte de réception s'y tenait, et parfois, sans doute à cause de la chaleur locale, des gens sortaient prendre un peu de fraîcheur sur le balcon, notamment cette belle brune à la poitrine avantageuse et fort bien mise en valeur, elle fut vite rejointe par une cohorte d'admirateurs. Combien étaient-ils ? J'aurais peine à le dire, toujours est-il qu'il y avait __du monde au balcon__ !
* L'escroc interrogé par la police et ligoté sur une chaise ne voulut pas __se mettre à table__
* La bOOnne [actrice|http://www.postershop-france.com/Dalle-Beatrice/Dalle-Beatrice-Photo-Beatrice-Dalle-6202233.html] kleptomane avait __piqué un fard__ dans la parfumerie de la rue Rambuteau.
* Landru était partisan de la __femme au foyer__.
* Le fakir, en visite à Paris se faisait un point d'honneur de __traverser dans les clous__.
* Madame Klein, par contre, avait un mari qui descendait __bouteilles sur bouteilles__.
ListeUnUne
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
ListeDeGensOuDeChosesQuiVontParDeux
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
!%%Center(LISTE DE GENS OU DE CHOSES QUI VONT PAR DEUX)%%
%%Center(µ''Par catégorie et par alpha''µ)%%
* Les Concorde Sierra Delta et Prototype 001, au Musée de l'air et de l'espace du Bourget, près de Paris ("Il y en a deux et c'est unique!")
* les [fesses|ListeDeMotsRelatifsAlaPartiePosterieuredesHumains]
* BNP Paribas
* Vert et Blanc (parfum)
* Place des 2 écus à Paris 1er
* Deux droites parallèlles
* [J'ai 2 amants (de Sacha Guitry et André Messager, chanté par Yvonne Printemps|http://perso.club-internet.fr/bmarcore/class-O/BO184.html]
**µµet le cul de la crèmière... oh pardon...µµ
* J'ai 2 amours (par Josephine Baker)
* Les surfaces de réparations
* Montparnasse Bienvenüe
* Les inséparables
* Mars & Sarpart
ListeDeLangues
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* La langue est un organe sexuel dont on se sert occasionnellement pour parler. ''Boris Vian''
ListesDesMotsDevenusIncorrectsEtDeCeuxQuiLesRemplacent
/* par PITIE ne mettez pas de liens vers de GROSSES images. merci
* __à l'étranger__ remplacé par ''à l'international''
* __à la mode__ remplacé par ''tendance''
* __action dépensant beaucoup d'énergie__ remplacé par ''action possédant une empreinte carbone non négligeable''
* __agent de la paix__ par ''policier''
* __arithmétique__ par ''mathématiques''
* __arts primitifs__ par ''arts premiers''
* __audition__ par ''casting''
* __aveugle__ remplacé par ''non-voyant''
* __balayeur__ remplacé par ''technicien de surface''[http://www.schtroumpfs.org/ecrire/upload/balayeur.jpg]
* __bande annonce__ remplacé par ''trailer''
* __b